GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2018-10-20 19:45:51, GGRNA.v2 : RefSeq release 90 (Sep, 2018)

LOCUS       XM_006724448            1501 bp    mRNA    linear   PRI 26-MAR-2018
DEFINITION  PREDICTED: Homo sapiens claudin 34 (CLDN34), transcript variant X1,
            mRNA.
ACCESSION   XM_006724448
VERSION     XM_006724448.3
DBLINK      BioProject: PRJNA168
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_000023.11) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 6, 2016 this sequence version replaced XM_006724448.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Homo sapiens Annotation Release 109
            Annotation Version          :: 109
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.0
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1501
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
     gene            1..1501
                     /gene="CLDN34"
                     /note="claudin 34; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 mRNA, 1 Protein, and
                     100% coverage of the annotated genomic feature by RNAseq
                     alignments, including 7 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100288814"
                     /db_xref="HGNC:HGNC:51259"
     variation       5..8
                     /gene="CLDN34"
                     /replace=""
                     /replace="cact"
                     /db_xref="dbSNP:1258537623"
     variation       8
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1460710728"
     variation       10
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1241900871"
     variation       15
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1354032661"
     variation       35
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1302378107"
     variation       36
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438528222"
     variation       37
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:901529375"
     variation       41..42
                     /gene="CLDN34"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:745397228"
     variation       41
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1373083438"
     variation       42
                     /gene="CLDN34"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1384392747"
     variation       43
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1238970240"
     variation       45..46
                     /gene="CLDN34"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1157001038"
     variation       49
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421732327"
     variation       54..55
                     /gene="CLDN34"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35651673"
     variation       62
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1473121371"
     variation       68
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173384630"
     variation       69
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:185954954"
     variation       70
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1248892753"
     variation       71
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:997195780"
     variation       74
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1445866118"
     variation       78
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1407411359"
     variation       79..80
                     /gene="CLDN34"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:755541786"
     variation       83
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1161685475"
     variation       90
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:12834690"
     variation       92
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:12834691"
     variation       99
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1389567958"
     variation       102
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1353968143"
     variation       117
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1050133492"
     variation       126..127
                     /gene="CLDN34"
                     /replace=""
                     /replace="ac"
                     /db_xref="dbSNP:1346867958"
     variation       126
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1231732560"
     variation       128
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275333880"
     variation       130
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28759214"
     variation       132
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006457389"
     variation       133
                     /gene="CLDN34"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:749235689"
     variation       144
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1016140313"
     variation       158
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768626403"
     variation       169
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:955851876"
     variation       174
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:962252425"
     variation       183
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993459518"
     variation       193
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192038875"
     variation       195
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1035665759"
     variation       211
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427720101"
     variation       229
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173577943"
     variation       230..231
                     /gene="CLDN34"
                     /replace=""
                     /replace="aggg"
                     /db_xref="dbSNP:746742668"
     variation       232
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371919790"
     variation       234
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747871624"
     variation       247
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:960046682"
     variation       249
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256287956"
     variation       263
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208322254"
     variation       270
                     /gene="CLDN34"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1348123695"
     variation       271
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1229632639"
     variation       284
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:183972645"
     variation       290
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:957422265"
     variation       302
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:916006909"
     variation       303
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1337349535"
     variation       311
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772485275"
     variation       316
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968869542"
     variation       317
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1220473031"
     variation       319
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:734543"
     variation       334
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1292848100"
     CDS             346..1122
                     /gene="CLDN34"
                     /codon_start=1
                     /product="claudin-34 isoform X1"
                     /protein_id="XP_006724511.2"
                     /db_xref="GeneID:100288814"
                     /db_xref="HGNC:HGNC:51259"
                     /translation="
MATVLMRTPSCLDQEAGAEELGRTSERSCVHVGPAGQFPGCAATMVWFCNSADCQFSVFALTTIGWILSSTSTGLVEWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDTFLPFEISMAQRFLLTASIFGFFGRAFNMFALRNMSMRMFEEDTYNSFVVSGILNIAAGVFNLIAVLQNYDAVINSQGITFLPSLQMPFKPDVQEVGTAIQVAGIGVLPMLLTGMFSLFYKCPPYGQVHPGISEM"
     variation       346
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:924832531"
     variation       352
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:990251510"
     variation       354
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934879234"
     variation       361
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280518259"
     variation       375
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409811708"
     variation       382
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1442763007"
     variation       393
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1181026877"
     variation       397
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477840460"
     variation       405
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1041298045"
     variation       411
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1249477016"
     variation       416
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:73476700"
     variation       417
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:915029825"
     variation       420
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766407262"
     variation       421
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1203479248"
     variation       441
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187630515"
     variation       442
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192120905"
     variation       447
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:939301013"
     variation       448
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1054700816"
     variation       451
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:888862225"
     variation       459
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:184420023"
     variation       461
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1261279970"
     variation       463
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:932135305"
     variation       464
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208179452"
     variation       467
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1259024443"
     variation       468
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966044271"
     variation       469
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767635394"
     variation       477
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:996226256"
     variation       478
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049270856"
     variation       480
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1029082000"
     variation       481
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1467021453"
     variation       490
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753096937"
     variation       501
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1421305763"
     variation       502
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160432896"
     variation       504
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1395085101"
     variation       510
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1304018604"
     variation       514
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1387914197"
     variation       517
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1433412856"
     variation       519
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:968573651"
     variation       526
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978605855"
     variation       529
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1005149743"
     variation       533
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1015242721"
     variation       539
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1376173175"
     variation       541
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896825408"
     variation       543
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868362360"
     variation       544
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1458430082"
     variation       552
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:188858350"
     variation       556
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1370867078"
     variation       557
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1392987804"
     variation       558
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1035174605"
     variation       563
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959189835"
     variation       565
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1012476641"
     variation       567
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1281796114"
     variation       568
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379201974"
     variation       570
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761151395"
     variation       576
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1033283739"
     variation       579
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369488375"
     variation       580
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:955960490"
     variation       587
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249304564"
     variation       592
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748775933"
     variation       594
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1178076599"
     variation       597
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770514244"
     variation       603
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:145798132"
     variation       606
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:5934730"
     variation       607
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:988702730"
     variation       609
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1395742216"
     variation       611..612
                     /gene="CLDN34"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:916875657"
     variation       612
                     /gene="CLDN34"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1200138056"
     variation       612
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1428035956"
     variation       614
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1168595204"
     variation       615
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759394306"
     variation       616
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:966451229"
     variation       618
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1331712359"
     variation       620
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1326998148"
     variation       624
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393499158"
     variation       628
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:73478917"
     variation       630
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:763865967"
     variation       631
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:922010248"
     variation       644
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1428962037"
     variation       646
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:932112249"
     variation       649
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292985740"
     variation       654
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1049228994"
     variation       657
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308822536"
     variation       658
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:909396098"
     variation       659
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1198913868"
     variation       662
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73478919"
     variation       664
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1373772460"
     variation       665
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181420307"
     variation       668
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:760860191"
     variation       669
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:756945238"
     variation       672
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1254250373"
     variation       673
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886618190"
     variation       680
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1184797464"
     variation       681
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421747700"
     variation       685
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1482988210"
     variation       686
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1273145281"
     variation       690
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:760452032"
     variation       697
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:907487366"
     variation       701
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:768507427"
     variation       704
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459717185"
     variation       715
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1327840218"
     variation       727
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1003616920"
     variation       739
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1056156338"
     variation       743
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1286565803"
     variation       744
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1363477887"
     variation       747
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218835391"
     variation       748
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776584207"
     variation       757
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1333141109"
     variation       758
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1235591910"
     variation       763
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:894875929"
     variation       767
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1332607904"
     variation       775
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764337267"
     variation       776
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1022060876"
     variation       783
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780637240"
     variation       784
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1234834475"
     variation       790
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1243870418"
     variation       791
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1486264262"
     variation       792
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761718377"
     variation       795
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255759695"
     variation       796
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474098188"
     variation       798
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1166759760"
     variation       799
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1414294147"
     variation       807
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:967858391"
     variation       808
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399987888"
     variation       815
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1156894390"
     variation       817..818
                     /gene="CLDN34"
                     /replace=""
                     /replace="at"
                     /db_xref="dbSNP:1346420812"
     variation       818
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1400148705"
     variation       820
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:879119455"
     variation       826
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1471901048"
     variation       841
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:902138137"
     variation       844
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1189044725"
     variation       859
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:999366384"
     variation       867
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030871048"
     variation       876
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766488797"
     variation       878
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1285113221"
     variation       887
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754094030"
     variation       893
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:976473538"
     variation       899
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1193771161"
     variation       900
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751637398"
     variation       912
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1287007142"
     variation       924
                     /gene="CLDN34"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1438901955"
     variation       924
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:5934731"
     variation       927
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210337935"
     variation       929
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1278305264"
     variation       930
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767724408"
     variation       931
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141064697"
     variation       936
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1293491204"
     variation       938
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1227449215"
     variation       940
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756457260"
     variation       942
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1469472045"
     variation       948
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1175406538"
     variation       949
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1410144278"
     variation       954
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1420246046"
     variation       961
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779996881"
     variation       963
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1373126483"
     variation       969
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1330465717"
     variation       970..980
                     /gene="CLDN34"
                     /replace=""
                     /replace="caaatgccctt"
                     /db_xref="dbSNP:1322921005"
     variation       976
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436142905"
     variation       984
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1334460833"
     variation       999
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1032817103"
     variation       1001
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1335516155"
     variation       1002..1007
                     /gene="CLDN34"
                     /replace=""
                     /replace="tggcac"
                     /db_xref="dbSNP:956069103"
     variation       1023
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166039617"
     variation       1026
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440553428"
     variation       1038
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1281771141"
     variation       1041
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749113663"
     variation       1044
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1234213237"
     variation       1045
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1278219228"
     variation       1060
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:988643871"
     variation       1072
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350203358"
     variation       1078
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1036571730"
     variation       1081
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:544288742"
     variation       1084
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201215367"
     variation       1085
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464236249"
     variation       1086
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1272644318"
     variation       1089
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928861845"
     variation       1090
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1202107995"
     variation       1096
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1455084761"
     variation       1099
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:73632619"
     variation       1101
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1056506535"
     variation       1118
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1438588570"
     variation       1119
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750878783"
     variation       1124
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1392699228"
     variation       1125
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1353444550"
     variation       1135
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455225946"
     variation       1138
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1386755308"
     variation       1146
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1161679286"
     variation       1150
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:930378894"
     variation       1153
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1395403101"
     variation       1156
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984953361"
     variation       1164
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1171319278"
     variation       1170
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372850880"
     variation       1178
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1407877243"
     variation       1185
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1253012431"
     variation       1192
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778658817"
     variation       1195
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138829828"
     variation       1209
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564091006"
     variation       1210
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758896369"
     variation       1211
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757807212"
     variation       1217
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373279347"
     variation       1221
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234124800"
     variation       1222
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61249528"
     variation       1225
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1337618743"
     variation       1227
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1216579977"
     variation       1230
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1348521369"
     variation       1235
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304191905"
     variation       1236
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252764505"
     variation       1243
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227803470"
     variation       1244
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1259697062"
     variation       1245
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1458085566"
     variation       1258
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184850323"
     variation       1259
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:902084508"
     variation       1263..1265
                     /gene="CLDN34"
                     /replace=""
                     /replace="ctt"
                     /db_xref="dbSNP:1251140496"
     variation       1265
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189363382"
     variation       1276
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1332618932"
     variation       1278
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437065571"
     variation       1295
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1396238108"
     variation       1296
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1167374298"
     variation       1300
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:901726890"
     variation       1303
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1421085936"
     variation       1304
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:180908433"
     variation       1324
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997460072"
     variation       1349
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113789759"
     variation       1365
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1482726758"
     variation       1367
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:185150460"
     variation       1374
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755797406"
     variation       1380
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1212001319"
     variation       1382
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485934418"
     variation       1384
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765743733"
     variation       1422
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1353520798"
     variation       1429
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1016354520"
     variation       1433
                     /gene="CLDN34"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1226150025"
     variation       1436
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1340117431"
     variation       1447
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1297896137"
     variation       1455
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:191090209"
     variation       1460
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1256224586"
     variation       1471
                     /gene="CLDN34"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1010009787"
     variation       1479..1482
                     /gene="CLDN34"
                     /replace=""
                     /replace="acaa"
                     /db_xref="dbSNP:1024115570"
     variation       1488
                     /gene="CLDN34"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:971262566"
     variation       1494
                     /gene="CLDN34"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:181832283"
     variation       1496
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:60359205"
     variation       1498
                     /gene="CLDN34"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:928833289"
     variation       1500
                     /gene="CLDN34"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1428447575"
ORIGIN      
attgcactccatgctgggtgacaagagtgaaactccgtcttaaaaaaaaaaaaagcattacctgcaggtgatatgagttagacaccagttctagggctggtggggagagagaaattaggagcccatacgaatgttggagtggaccctgcaggtgtattagcaaacatacctaccctccaaaggctgacagagcaaaagaggctacatgatgaagcaaatgaagcaactaaagggtggtggctgcagcgacctcaggacctaggactgacacctggatgagcagggtgactggtggaatgtgggaacagaacagaacattgagggagggcctcagaactggaaaccatggctaccgtgttgatgagaactcccagctgcctggaccaagaagccggtgctgaagaactaggcaggacgtccgagaggagctgtgtccatgtcggccccgctggccagtttcctgggtgcgctgccaccatggtctggttctgcaacagtgccgactgccaattttcagtcttcgcccttaccaccataggatggatcctctcctctacgtccacgggcctcgtggagtggcgaatatggtacatgaaagacacctcgctctacccccctggaatcgcctgcgtgggaatatttagagtctgcatttaccggcgtcgcaccaacagcaccacaaccaaattttgttaccgatacagctaccaggacacctttctcccttttgaaatttccatggctcaacgcttcctactgactgccagcattttcggattcttcgggagagcctttaacatgtttgcacttagaaacatgtccatgagaatgtttgaggaggacacctacaattcattcgttgtttcaggaattctcaacattgctgctggtgtctttaacttaattgctgtgctccagaactacgatgccgtcataaactcacaggggatcaccttcctgccatctctccaaatgcccttcaagccagatgtgcaggaagttggcactgccattcaagtggcagggataggtgtcttgccgatgctgttaactgggatgttttctctgttttacaaatgtcccccgtacggccaagtgcatcctggtatttcagaaatgtgaatttcctggttgcattggctttgcaaatctaagatttctgggagtttatggaaaatgttattagcatgctctaccaaatatttccaacgactcaagaccgtggcatgggtagtttgggacagaaggtggccaactgcctccttctgttatcttgtgtatctgaatgtggctcactgatttgttggttgaattgagaacttttatttaaaagtcttcccacctgccagttggtcttattgcatctgaattttaattattgttggctacagcaaataatcaaccctgtaaactaagagtagggaaataagagtttctgagtacattaacttctcacatttccctcttaaacttttgctacaaacaatcataggccaggcat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]