2024-04-26 18:54:10, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006603341 513 bp mRNA linear PLN 19-APR-2021 DEFINITION PREDICTED: Glycine max uncharacterized LOC102661198 (LOC102661198), mRNA. ACCESSION XM_006603341 VERSION XM_006603341.1 DBLINK BioProject: PRJNA48389 KEYWORDS RefSeq; includes ab initio. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Phaseoleae; Glycine; Glycine subgen. Soja. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_038254.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Glycine max Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..513 /organism="Glycine max" /mol_type="mRNA" /cultivar="Williams 82" /db_xref="taxon:3847" /chromosome="18" /tissue_type="callus" gene 1..513 /gene="LOC102661198" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:102661198" CDS 1..513 /gene="LOC102661198" /codon_start=1 /product="uncharacterized protein LOC102661198" /protein_id="XP_006603404.1" /db_xref="GeneID:102661198" /translation="
MDPVKYIFEKPTLTEQIARWQVLLSEFNIVYVTQKAIKGSALEDYLAQQPINDYQPMHPEFPDEVIMTLFEEEMGDEDREKWIVWFDGKSNALGHRVGAVLVTPDDQCIPFTARLGLDCMNNMSEYEACALGIQAAIDFKVKLLKVYGDLAFVIHQLKGEWETRDHKLIP"
misc_feature <7..96 /gene="LOC102661198" /note="Ribonuclease H-like superfamily, including RNase H, HI, HII, HIII, and RNase-like domain IV of spliceosomal protein Prp8; Region: RNase_H_like; cl14782" /db_xref="CDD:449355" misc_feature 244..>510 /gene="LOC102661198" /note="Ribonuclease H-like superfamily, including RNase H, HI, HII, HIII, and RNase-like domain IV of spliceosomal protein Prp8; Region: RNase_H_like; cl14782" /db_xref="CDD:449355" misc_feature order(259..270,361..366,373..375,445..447) /gene="LOC102661198" /note="RNA/DNA hybrid binding site [nucleotide binding]; other site" /db_xref="CDD:259998" ORIGIN
atggacccagtcaagtacatatttgaaaagcccaccctcaccgaacagatcgctcggtggcaggttctattgtcagaattcaacattgtttatgtcacacaaaaggcaataaagggaagtgccttggaagactacttggctcagcagcccatcaatgactatcaaccaatgcaccccgagttccctgacgaggtcatcatgaccttgttcgaggaggagatgggggatgaagatagggagaaatggattgtgtggtttgacggcaagtccaacgcactaggccatagagtaggggcagttttggttacccccgatgatcaatgtatacccttcacagctaggttgggcttagactgcatgaataacatgtctgagtacgaggcatgcgcccttgggatccaagcagcaattgacttcaaggtcaagttgctcaaagtatatggggacttagcctttgtgatccaccaattgaaaggagaatgggagaccagggatcacaagttgataccctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]