2024-05-20 09:43:01, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006602497 282 bp mRNA linear PLN 19-APR-2021 DEFINITION PREDICTED: Glycine max plasma membrane ATPase 2-like (LOC102660489), mRNA. ACCESSION XM_006602497 VERSION XM_006602497.2 DBLINK BioProject: PRJNA48389 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; NPAAA clade; indigoferoid/millettioid clade; Phaseoleae; Glycine; Glycine subgen. Soja. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_038254.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Nov 25, 2015 this sequence version replaced XM_006602497.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Glycine max Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..282 /organism="Glycine max" /mol_type="mRNA" /cultivar="Williams 82" /db_xref="taxon:3847" /chromosome="18" /tissue_type="callus" gene 1..282 /gene="LOC102660489" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 89 samples with support for all annotated introns" /db_xref="GeneID:102660489" CDS 49..282 /gene="LOC102660489" /codon_start=1 /product="plasma membrane ATPase 2-like" /protein_id="XP_006602560.1" /db_xref="GeneID:102660489" /translation="
MTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDADTVVLMAAQASRLENQDAIDTAIVGMLADPKEVSH"
misc_feature <49..>270 /gene="LOC102660489" /note="plasma-membrane proton-efflux P-type ATPase; Region: ATPase-IIIA_H; TIGR01647" /db_xref="CDD:273731" ORIGIN
ttaatggttaattagtaatgatttttgtagggggctatcacaaagagaatgacagctattgaagagatggcaggcatggatgtgctttgcagtgataagactgggaccctaacactaaataagcttactgttgacaaaaatcttatagaggtttttgcaaaaggagtggatgcggatactgttgttttgatggcagctcaagcttcaagacttgagaatcaagatgcaatagacactgccatagttggaatgttggctgatcccaaagaggttagtcattga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]