LOCUS       XM_006360607             620 bp    mRNA    linear   PLN 05-JAN-2016
DEFINITION  PREDICTED: Solanum tuberosum uncharacterized LOC102592064
            (LOC102592064), mRNA.
ACCESSION   XM_006360607
VERSION     XM_006360607.2
DBLINK      BioProject: PRJNA225997
KEYWORDS    RefSeq.
SOURCE      Solanum tuberosum (potato)
  ORGANISM  Solanum tuberosum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Solaneae; Solanum.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006239252.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jan 5, 2016 this sequence version replaced XM_006360607.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Solanum tuberosum Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..620
                     /organism="Solanum tuberosum"
                     /mol_type="mRNA"
                     /cultivar="DM 1-3 516 R44"
                     /db_xref="taxon:4113"
                     /chromosome="Unknown"
     gene            1..620
                     /gene="LOC102592064"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 ESTs, and 91% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     30 samples with support for all annotated introns"
                     /db_xref="GeneID:102592064"
     CDS             54..428
                     /gene="LOC102592064"
                     /codon_start=1
                     /product="uncharacterized protein LOC102592064"
                     /protein_id="XP_006360669.1"
                     /db_xref="GeneID:102592064"
                     /translation="

MKFLSELRTCYGGATIKTVMDGLPPVEKKESEQVNRSGNKRVVSRGRKLRKTENWKPALHVISEDKAIADVDRYSCDKTTVGNSGNKRALKDDGRSGRARKRFGDGYWKMSYAVAMPAFSGMLF"

ORIGIN      

acctcaattttcaaaattcacaactgtagataaatatcctgtatatattcaatatgaagtttttatcggaattaaggacgtgctatggcggtgcaaccatcaagacggtgatggatgggctaccgccggtggagaaaaaggagtcggagcaagtaaatcgatcggggaataaacgcgtggtttctcggggaaggaaattaaggaaaacggagaattggaaaccggcgctccacgtcatctccgaggacaaagcgatcgccgacgttgatcggtacagttgcgataaaactacggttggaaattccgggaataaaagagcgttaaaagatgacggtagatctggtagagcacggaagaggttcggcgatggttactggaaaatgtcgtacgccgttgcgatgcctgctttctcaggaatgcttttttagtgttgagctgtgtttgtcttgtccttgtaaataattagattttagatttttgttcacctctatggaaatttaacaaaagcaaaaatatatgccttttaatttctttgtatatatattgtaaataaaaaaaatgatgttcaagttaattgatatttggttttgtaattttatacaaatttatttttgatttta

//