2024-03-29 22:57:35, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_006359188 1742 bp mRNA linear PLN 05-JAN-2016 DEFINITION PREDICTED: Solanum tuberosum putative dual specificity protein phosphatase DSP8 (LOC102603222), mRNA. ACCESSION XM_006359188 VERSION XM_006359188.2 DBLINK BioProject: PRJNA225997 KEYWORDS RefSeq. SOURCE Solanum tuberosum (potato) ORGANISM Solanum tuberosum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_006239216.1) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Jan 5, 2016 this sequence version replaced XM_006359188.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Solanum tuberosum Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.5 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1742 /organism="Solanum tuberosum" /mol_type="mRNA" /cultivar="DM 1-3 516 R44" /db_xref="taxon:4113" /chromosome="Unknown" gene 1..1742 /gene="LOC102603222" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 ESTs, 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 83 samples with support for all annotated introns" /db_xref="GeneID:102603222" CDS 512..1546 /gene="LOC102603222" /codon_start=1 /product="putative dual specificity protein phosphatase DSP8" /protein_id="XP_006359250.1" /db_xref="GeneID:102603222" /translation="
MYIEEEKGEELETGKEEMVVGGVIEKAEKLSVSGKVLCSSGSSGNNAIVVLDVRRVMVGVGARALFYPTLLYNVVRNKIQVEFRWWDWIDEFVLLGAVPFQSDVKRLKELGVSGVVTLNEPYETLVPTSLYEAHGIRHLVLPTRDYLFAPSLNNICQAVEFIHENASNGQSTYVHCKAGRGRSTTIVLCYLVKYKQMTPNDAYNYVKSIRPRVLLASTQRQAVQDFYHLMVKKSYSSTPLTSMIPRSSIFSRRNLLAFDDGAVVVITETDLDGYNSSLDSRVAGSELWADLNLIYRVRVAGGAALARLSCMWLRCHTDQKIPNQKVTAESKQLESFTVDIHVFS"
misc_feature 764..1192 /gene="LOC102603222" /note="protein-tyrosine phosphatase mitochondrial 1; Region: PTPMT1; cd14524" /db_xref="CDD:350374" misc_feature order(764..766,803..805,947..949,1037..1057,1157..1159) /gene="LOC102603222" /note="active site" /db_xref="CDD:350374" ORIGIN
attaaaatgtttgaaatttcgtggcacacatatacagaggggacaatctgaattctcaagtagagtattgtctagggttcgtcaattccaagctatcttcactcttttaccgattccgattcaattgcttttgcaaatcgagggtctcaactatctccgtcagatcttggccgtccgattgatacctttttctctgaatatggtcgaaatttgcaagccttatattgatttcaatcaaagttcgaacctttgttgtaatttcagcgactcagatccgtttcacagataatttgcctaattttgagagaagggtccggtttgtttgtatgttgattttgaagagagtcgtctcttagtttgaaattttaggtggaagtttgtggaatttgcactttgtttatcagtgcgttgtgtaaattttctttagtttgtgtgttctgcatcttgtttttccctctttatttgatcagtgggttgtatataatattttttttgtcttccaagtattattatgtatatagaggaagagaagggagaagagttggagactgggaaggaggagatggtggtgggtggagtgatagagaaggcagagaaattatctgtttctggtaaggtgttgtgttctagtggtagtagtggcaataatgctattgttgtgttggatgtaaggagggtcatggttggagttggggctcgagccttgttttacccgacacttctctacaatgttgttaggaacaagattcaggtagagtttcgatggtgggactggattgatgagtttgtgttattaggtgctgtccctttccaatctgatgtgaaaaggctaaaggagcttggtgtctccggtgttgtcaccctaaatgagccatatgagactttagttccgacatctttatatgaggctcatggtattcgtcatttggttctcccaacaagagattacttatttgccccatctctgaataatatatgtcaagcagtagagttcatccatgaaaatgcttccaatggacaaagtacatatgtgcactgcaaggctggtcgaggacgtagcacgaccattgtcttatgctacttggttaagtacaagcagatgacaccaaatgatgcatataactatgtgaagtcaattcgtccaagggtgcttttggcctctacccagcgacaggctgtccaggatttttaccatctcatggtgaaaaagtcatacagttctacccccttgactagtatgatcccacggagctcaatcttctccagacggaatttgctagccttcgatgatggtgctgtagttgtgataaccgaaacagatctagatggatataattcaagccttgactctagggtggctggatctgagctttgggcagatttgaatttgatttacagggttcgagttgctggtggggcagccttagcaagactctcctgtatgtggttacgttgccacaccgaccagaagattccgaatcagaaggtgactgcagagagcaagcagctggaaagttttactgtagatatacatgtgttttcttaagttaataagttgtacatatttcttctgtatatataaaatattaagatgctacaagctaaggtgtctactatttcagcttactctaccataaaacctcgacgttctctatgtaaatacgatatacttctcaagttgcaaatgagaagtttgagtatatgtatatatatatagctctttatgcgaaatttcttaacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]