GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 07:44:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_006345987            1007 bp    mRNA    linear   PLN 05-JAN-2016
DEFINITION  PREDICTED: Solanum tuberosum uncharacterized LOC102584377
            (LOC102584377), mRNA.
ACCESSION   XM_006345987
VERSION     XM_006345987.2
DBLINK      BioProject: PRJNA225997
KEYWORDS    RefSeq.
SOURCE      Solanum tuberosum (potato)
  ORGANISM  Solanum tuberosum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; lamiids; Solanales; Solanaceae;
            Solanoideae; Solaneae; Solanum.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_006239000.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jan 5, 2016 this sequence version replaced XM_006345987.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Solanum tuberosum Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1007
                     /organism="Solanum tuberosum"
                     /mol_type="mRNA"
                     /cultivar="DM 1-3 516 R44"
                     /db_xref="taxon:4113"
                     /chromosome="Unknown"
     gene            1..1007
                     /gene="LOC102584377"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, 2 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 66 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:102584377"
     CDS             76..537
                     /gene="LOC102584377"
                     /codon_start=1
                     /product="uncharacterized protein LOC102584377"
                     /protein_id="XP_006346049.1"
                     /db_xref="GeneID:102584377"
                     /translation="
MSNEAPEKPPCNTPEHDSASTVVDGDGVNDNNDTSNSALAKGLSTIISSIIREFDGSAAATSRSQDQLSSTLDRLTGELDKLLEDAPLPFIMQHAARISGVRKRITSLNSLLKSIQRRLDSIDHTLSAGLIHEQSTGDGGRDHENHKSSLKSS"
     misc_feature    187..444
                     /gene="LOC102584377"
                     /note="Snapin/Pallidin; Region: Snapin_Pallidin;
                     pfam14712"
                     /db_xref="CDD:434149"
ORIGIN      
taactataattaaggccaaattttttatttattttttccctttgacattcctgctgacgagtaccggaaaagacaatgtcgaacgaagccccagaaaaaccaccgtgcaacaccccggagcatgactcagccagtactgtcgtcgacggtgacggtgtaaacgacaacaacgacacttcaaattctgccttagcgaagggcctttccaccataatatcttctataatccgggaatttgatggcagcgctgccgccacctctcgtagtcaagatcagctctcttccactctcgatcgtctcactggagagcttgataagctgctggaagatgccccattgccttttatcatgcagcatgctgccagaatttctggtgttaggaaaagaattacatcattgaactcacttttgaagtctatacagaggcgtcttgatagtatcgaccacacattatctgctggtttgatacatgagcagtccacaggggatggtgggcgagaccatgagaaccataagtcttcattgaagagttcatgatcaaaatccagagaagattcaaatgtccttcgcagtgcctgtagacgctccttctgattgattgtgcaagcatttggaactgattcagcctggtggtgtaaaaggtagtctgatgcatgaagttacaacactctggcattctgaaaagatgttcttttacctatcaaaattgctcgttttcagcttgtgccacagtatgtccgagttgcccagaaaagcaaaacattataaaatggaaaacgtgtggtgactggtttagcagctcaactactgtaggccggcctgtaggtacaatttgaagggggggaatctttgtgaaactgaactcttatattctgctccgaaacatattgttaatcgttttgcattgcatcagataggtgtactttgttttacaacttgacattttattgtataatgtgtattcatgattctataattgataagaccagtgattggtggttctgaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]