2024-05-20 10:50:46, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_005853002 1040 bp mRNA linear MAM 04-NOV-2015 DEFINITION PREDICTED: Myotis brandtii cathepsin O-like (LOC102254807), mRNA. ACCESSION XM_005853002 VERSION XM_005853002.2 DBLINK BioProject: PRJNA218631 KEYWORDS RefSeq. SOURCE Myotis brandtii (Brandt's bat) ORGANISM Myotis brandtii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Microchiroptera; Vespertilionidae; Myotis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_005325292.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Nov 4, 2015 this sequence version replaced XM_005853002.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Myotis brandtii Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1040 /organism="Myotis brandtii" /mol_type="mRNA" /db_xref="taxon:109478" /chromosome="Unknown" /sex="male" /country="Russia: Perm poKrai" /lat_lon="58.8348 N 57.6119 E" /collection_date="Dec-2011" /note="collected at hibernation roost" gene 1..1040 /gene="LOC102254807" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 27 samples with support for all annotated introns" /db_xref="GeneID:102254807" CDS 382..633 /gene="LOC102254807" /codon_start=1 /product="cathepsin O-like" /protein_id="XP_005853064.1" /db_xref="GeneID:102254807" /translation="
MAKALLTFGPLVGIVDAVSWQDYLGGIIQHHCSSGEANHAIIITGFDKTGTTPYWIVRNSWGSSWGVDGYAHVKMGSNICGES"
misc_feature <382..624 /gene="LOC102254807" /note="C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase). Papain-like enzymes are mostly endopeptidases with some...; Region: Peptidase_C1; cl23744" /db_xref="CDD:451520" ORIGIN
aatgtgtgtgttacttctgggaaatcttctcaacaggaatgcaacacctctcctttctactccctgctgaaaggaatatatgttaaatggctggagctcctgaagccatcttggaccattaattgaacttgggaatggacacctcacatggcagaataatagcataagaggagcctgggttcttgatatctattgcagtcctggactaccagtctcctagacttcttgtagcctccattgtttaagtcttctgtaattgcaaccaaacctatgtgtatccatacagagattaaagagatcgttttaatacaatattcttaccttaaaaactaaactccttaaccaaatattttctcttttggtagtgaccaagaagacgaaatggcaaaagcactccttacctttggtcctttggtagggatagtagatgcagtgagctggcaagattacctgggagggataatacagcatcactgctctagtggagaagcaaatcatgctattatcataactgggtttgataaaacaggaactactccatattggattgtacggaactcatggggaagttcctggggagtggatggctatgcccatgtgaaaatgggaagtaatatttgcggtgagtcatgaatttgtgtttaaagctccagcctaagtgtcaaggaagatattctgaatatattaaaattataaacctgtccaatccatagtatgtttccaacatactcacatcacttaataattgataaaaatagaatagttttttaaagaagagacactattgcacatattcatgctttaaaaaggaagaaagactgtagtaaaaacaaatataataagcaaaacataataagataaactaataatttaccaaagttaactacttcaaaatccagaggcttttggatttaaaaatactcaacttaggaggctgaagttctccaaaaagtcccctcgttccaattttacttgttataactgtatgagtttttcttaatttgtgcattaataatacttgcacaaagattgtcaagcat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]