GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-17 03:18:00, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_004695880            1062 bp    mRNA    linear   MAM 10-JUN-2015
DEFINITION  PREDICTED: Condylura cristata VCP-interacting membrane
            selenoprotein (VIMP), mRNA.
ACCESSION   XM_004695880
VERSION     XM_004695880.2
DBLINK      BioProject: PRJNA193510
KEYWORDS    RefSeq.
SOURCE      Condylura cristata (star-nosed mole)
  ORGANISM  Condylura cristata
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Eulipotyphla; Talpidae;
            Condylura.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_004567136.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jun 10, 2015 this sequence version replaced XM_004695880.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Condylura cristata Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.3
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1062
                     /organism="Condylura cristata"
                     /mol_type="mRNA"
                     /isolate="star-nosed mole 26May11"
                     /db_xref="taxon:143302"
                     /chromosome="Unknown"
                     /sex="female"
     gene            1..1062
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 8 mRNAs, 11 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 3 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:101636247"
     CDS             43..606
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S"
                     /protein_id="XP_004695937.2"
                     /db_xref="GeneID:101636247"
                     /translation="
MEPDGEQLAARPALETEGLRFLHVTVGSLLATYGWYILFSCILLYVVFQKLSTRLRVLRQRQLDQAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYRGSARKPQEEDSPGPSTSVIPKRKPDRKPLRGGGYNPLSGEGGGACSWRPGRRGPTSGG"
     misc_feature    46..603
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      
cgcagtctcgagctgacgcggctgggcagcttggcggcggccatggagccggacggggagcagctggccgcgcggccagccctggagacagaggggctgcgcttcctgcacgtcacggtgggctccctgctggccacctatggctggtacatcctcttcagctgcatcctcctctacgtggtctttcagaagctctccacccggctgagggtcttgaggcagaggcagctggaccaggctgcagcagctgtggagcctgatgttgttgttaaacggcaagaggctttagcagctgctcgtttgaaaatgcaagaggaattaaatgcccaagttgaaaaacataaagaaaaactaaaacagcttgaagaagaaaaaagaagacagaagatagaaatgtgggacagcatgcaagaggggaaaagctacagaggaagcgcaaggaagccgcaggaggaagacagccctgggccttccacttcagtcatccccaaacgaaaacccgacaggaagcctttgcgaggaggcgggtacaaccctttgtctggtgaaggagggggagcctgctcctggagacccggacgcagaggcccgacatctggtggatgaggctaagagtcttgttagtgtcgtctttgacattagcaagaagaatccttaaccctcaattcaactgcctcaacgcacacttttcacagtgactagccagggagtggagtttctttcttttcttagctttacctttaagggagaaagccagcacaccagaatcagtagatcattggccacacttcactaaatctattcattggtttatggtaattgctagttagtaggtgaacgcctctaggtgatgagcaattttgacgaaagagttggatttctaaggctggcaggtagggcgtgtctgtgacgggtgcgttgaatgatgtcttcctcggaaacggtgagccaccggtgaggattactgatgcagacagttattgaggtagtttctgtatatttgtttttatgtacagaactttgtagaaaacttgtaaatattaaaacaatgcaaaaaccgtt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]