LOCUS       XM_004503142             990 bp    mRNA    linear   PLN 14-DEC-2018
DEFINITION  PREDICTED: Cicer arietinum protein NBR1 homolog (LOC101498514),
            transcript variant X1, mRNA.
ACCESSION   XM_004503142
VERSION     XM_004503142.3
DBLINK      BioProject: PRJNA190909
KEYWORDS    RefSeq.
SOURCE      Cicer arietinum (chickpea)
  ORGANISM  Cicer arietinum
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50
            kb inversion clade; NPAAA clade; Hologalegina; IRL clade; Cicereae;
            Cicer.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_021165.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 14, 2018 this sequence version replaced XM_004503142.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Cicer arietinum Annotation Release
                                           102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..990
                     /organism="Cicer arietinum"
                     /mol_type="mRNA"
                     /cultivar="CDC Frontier"
                     /db_xref="taxon:3827"
                     /chromosome="Ca6"
                     /tissue_type="etiolated seedlings"
                     /country="India"
                     /collection_date="Oct-2011"
     gene            1..990
                     /gene="LOC101498514"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 136
                     samples with support for all annotated introns"
                     /db_xref="GeneID:101498514"
     CDS             244..642
                     /gene="LOC101498514"
                     /codon_start=1
                     /product="protein NBR1 homolog"
                     /protein_id="XP_004503199.1"
                     /db_xref="GeneID:101498514"
                     /translation="

MYLSSVYTIGCNFFIAFVLIAMDSAMVIKVKYEDTLRRFSASVEENSRLDLNMVGLRAKISSIFNFTAYANFILRYVDEDGDLVNLVDDDDLRDVMRQQLKFLRIDVHMINNSGGKSDADGSSGSATPLNMI"

     misc_feature    319..564
                     /gene="LOC101498514"
                     /note="The PB1 domain is a modular domain mediating
                     specific protein-protein interactions which play a role in
                     many critical cell processes, such as osteoclastogenesis,
                     angiogenesis, early cardiovascular development, and cell
                     polarity. A canonical PB1-PB1...; Region: PB1; cl02720"
                     /db_xref="CDD:413452"
     misc_feature    order(322..324,328..330,349..357,418..420,430..432)
                     /gene="LOC101498514"
                     /note="PB1 interaction surface [polypeptide binding];
                     other site"
                     /db_xref="CDD:99716"
     misc_feature    order(322..324,328..330,346..354,418..420)
                     /gene="LOC101498514"
                     /note="PB1 interaction [polypeptide binding]; other site"
                     /db_xref="CDD:99716"
     misc_feature    order(328..330,430..432)
                     /gene="LOC101498514"
                     /note="PB1 interaction surface [polypeptide binding];
                     other site"
                     /db_xref="CDD:99716"
ORIGIN      

taagaaattaggtgtgcaaaatgtgtttgaattttacggaatcaattcagattgtcatttttatttctgtatcttcctgattgacaatttcaattgtgtgatgtgtattttgctatttatagtgattttttaatgccctaatgactttgaaaaaccaaaaaattggaactcttcgttagttaaaatttgatttctaacaaatatttgattaaagaacttttgtaaatacaatttcagtaagggatgtatttatcttctgtatatacaattggttgtaacttcttcatcgctttcgttctcatagctatggactctgctatggtgatcaaggtgaaatatgaagatactctcaggcgcttcagtgctagtgtggaagagaacagtcgcctggatcttaatatggttgggttgagagctaagataagttctattttcaacttcaccgcctatgcaaattttattctgaggtatgttgatgaagatggagacttggtgaatcttgtggatgatgatgatttgcgtgatgtgatgagacaacaattaaaattcttgagaattgatgtacatatgatcaataattctggtggtaaatcagatgctgatggttctagtggaagtgccacccctttaaacatgatttgaggcttgtactagcagcctccagtgtcggtcgacaggtggaggctggaaatgtgggagtcgccccagttgatctcaatactctccatgtgatccatattcacacattaatgtagatagtgcaccactttcatcagcagttcatgtaagtgatgacaagggtaaaacgtctattgttgatagtcttgctggtaagggtgaaatatgtggaacatcaatgaattttgtcgctcccaattacaccccaaccaatagtcatgctacaagttacagtacccctattgactgtccattttctgggacacatactctttattcaatgccacctcctctaggaaacatctgcattcc

//