LOCUS       XM_004310461             663 bp    mRNA    linear   MAM 27-APR-2020
DEFINITION  PREDICTED: Tursiops truncatus putative claudin-24 (LOC101337537),
            mRNA.
ACCESSION   XM_004310461
VERSION     XM_004310461.1
DBLINK      BioProject: PRJNA625792
KEYWORDS    RefSeq.
SOURCE      Tursiops truncatus (common bottlenose dolphin)
  ORGANISM  Tursiops truncatus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha;
            Cetacea; Odontoceti; Delphinidae; Tursiops.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_047054.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Tursiops truncatus Annotation
                                           Release 102
            Annotation Version          :: 102
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..663
                     /organism="Tursiops truncatus"
                     /mol_type="mRNA"
                     /isolate="mTurTru1"
                     /db_xref="taxon:9739"
                     /chromosome="21"
                     /sex="male"
                     /tissue_type="spleen"
                     /country="USA: Baltimore, Maryland"
                     /lat_lon="39.2851 N 76.6083 W"
                     /collection_date="11-Nov-2018"
                     /collected_by="Leigh Clayton, Jill Arnold, Winston Timp,
                     Norah Hilger"
     gene            1..663
                     /gene="LOC101337537"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 mRNAs, 5 Proteins, and 18%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:101337537"
     CDS             1..663
                     /gene="LOC101337537"
                     /codon_start=1
                     /product="putative claudin-24"
                     /protein_id="XP_004310509.1"
                     /db_xref="GeneID:101337537"
                     /translation="

MALVFRVAMQFVGILLSLLGWVLSIITTFLPHWKNLNLDLNEMENWTVGLWQTCVTQEEVGMQCKDFDSFLALPAELRISRILMFLSNGLGFLGLLVSGFGLDCLRIGERQQDVKKQLLILGGILFWTAGVTALVPVSWVAHRTVQEFWDETIPEIVPRWEFGEALFIGWFAGFSLLLGGCLLNWAACGTQIPLASGHYAVAEMQTQCSYLENGTANPSV"

     misc_feature    28..549
                     /gene="LOC101337537"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      

atggctttagtctttagagtagcaatgcaattcgttggaattttgctatctctgctgggatgggttttatccattattacaacttttttgccacattggaaaaacctcaacctggacttaaatgaaatggaaaactggactgtgggactctggcagacctgcgtcacccaagaggaagtggggatgcaatgcaaggactttgattctttcctggctttgcccgctgagctcaggatctccaggattttaatgttcctctcaaacggcctgggattcctgggcctgctggtctcggggtttggcctggactgcttgagaattggagagagacagcaggatgtcaagaagcagctgttaatcctgggaggaattctgttctggacagcaggcgtcacagcccttgttcctgtctcttgggtcgcccacaggacagtccaggagttctgggatgagaccatccccgagattgtgcccaggtgggagtttggggaggccctctttatcggctggtttgctggattttctctcctgctcggagggtgtctgctaaactgggccgcctgcgggacccagattcccctggcttccggccactatgcagtggcagaaatgcaaactcagtgttcatacctggagaatggaactgccaatccttcagtgtaa

//