2024-04-20 14:36:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_004310461 663 bp mRNA linear MAM 27-APR-2020 DEFINITION PREDICTED: Tursiops truncatus putative claudin-24 (LOC101337537), mRNA. ACCESSION XM_004310461 VERSION XM_004310461.1 DBLINK BioProject: PRJNA625792 KEYWORDS RefSeq. SOURCE Tursiops truncatus (common bottlenose dolphin) ORGANISM Tursiops truncatus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Whippomorpha; Cetacea; Odontoceti; Delphinidae; Tursiops. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_047054.1) annotated using gene prediction method: Gnomon, supported by mRNA evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Tursiops truncatus Annotation Release 102 Annotation Version :: 102 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..663 /organism="Tursiops truncatus" /mol_type="mRNA" /isolate="mTurTru1" /db_xref="taxon:9739" /chromosome="21" /sex="male" /tissue_type="spleen" /country="USA: Baltimore, Maryland" /lat_lon="39.2851 N 76.6083 W" /collection_date="11-Nov-2018" /collected_by="Leigh Clayton, Jill Arnold, Winston Timp, Norah Hilger" gene 1..663 /gene="LOC101337537" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 5 Proteins, and 18% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:101337537" CDS 1..663 /gene="LOC101337537" /codon_start=1 /product="putative claudin-24" /protein_id="XP_004310509.1" /db_xref="GeneID:101337537" /translation="
MALVFRVAMQFVGILLSLLGWVLSIITTFLPHWKNLNLDLNEMENWTVGLWQTCVTQEEVGMQCKDFDSFLALPAELRISRILMFLSNGLGFLGLLVSGFGLDCLRIGERQQDVKKQLLILGGILFWTAGVTALVPVSWVAHRTVQEFWDETIPEIVPRWEFGEALFIGWFAGFSLLLGGCLLNWAACGTQIPLASGHYAVAEMQTQCSYLENGTANPSV"
misc_feature 28..549 /gene="LOC101337537" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" ORIGIN
atggctttagtctttagagtagcaatgcaattcgttggaattttgctatctctgctgggatgggttttatccattattacaacttttttgccacattggaaaaacctcaacctggacttaaatgaaatggaaaactggactgtgggactctggcagacctgcgtcacccaagaggaagtggggatgcaatgcaaggactttgattctttcctggctttgcccgctgagctcaggatctccaggattttaatgttcctctcaaacggcctgggattcctgggcctgctggtctcggggtttggcctggactgcttgagaattggagagagacagcaggatgtcaagaagcagctgttaatcctgggaggaattctgttctggacagcaggcgtcacagcccttgttcctgtctcttgggtcgcccacaggacagtccaggagttctgggatgagaccatccccgagattgtgcccaggtgggagtttggggaggccctctttatcggctggtttgctggattttctctcctgctcggagggtgtctgctaaactgggccgcctgcgggacccagattcccctggcttccggccactatgcagtggcagaaatgcaaactcagtgttcatacctggagaatggaactgccaatccttcagtgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]