LOCUS       XM_003846808             813 bp    mRNA    linear   PLN 06-FEB-2020
DEFINITION  Zymoseptoria tritici IPO323 uncharacterized protein
            (MYCGRDRAFT_98091), partial mRNA.
ACCESSION   XM_003846808
VERSION     XM_003846808.1
DBLINK      BioProject: PRJNA170847
            BioSample: SAMN02746078
KEYWORDS    RefSeq.
SOURCE      Zymoseptoria tritici IPO323 (Mycosphaerella graminicola IPO323)
  ORGANISM  Zymoseptoria tritici IPO323
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Dothideomycetidae; Mycosphaerellales;
            Mycosphaerellaceae; Zymoseptoria.
REFERENCE   1  (bases 1 to 813)
  AUTHORS   Goodwin,S.B., Ben M'barek,S., Dhillon,B., Wittenberg,A.H.,
            Crane,C.F., Hane,J.K., Foster,A.J., Van der Lee,T.A., Grimwood,J.,
            Aerts,A., Antoniw,J., Bailey,A., Bluhm,B., Bowler,J., Bristow,J.,
            van der Burgt,A., Canto-Canche,B., Churchill,A.C.,
            Conde-Ferraez,L., Cools,H.J., Coutinho,P.M., Csukai,M., Dehal,P.,
            De Wit,P., Donzelli,B., van de Geest,H.C., van Ham,R.C.,
            Hammond-Kosack,K.E., Henrissat,B., Kilian,A., Kobayashi,A.K.,
            Koopmann,E., Kourmpetis,Y., Kuzniar,A., Lindquist,E., Lombard,V.,
            Maliepaard,C., Martins,N., Mehrabi,R., Nap,J.P., Ponomarenko,A.,
            Rudd,J.J., Salamov,A., Schmutz,J., Schouten,H.J., Shapiro,H.,
            Stergiopoulos,I., Torriani,S.F., Tu,H., de Vries,R.P., Waalwijk,C.,
            Ware,S.B., Wiebenga,A., Zwiers,L.H., Oliver,R.P., Grigoriev,I.V.
            and Kema,G.H.
  TITLE     Finished Genome of the Fungal Wheat Pathogen Mycosphaerella
            graminicola Reveals Dispensome Structure, Chromosome Plasticity,
            and Stealth Pathogenesis
  JOURNAL   PLoS Genet. 7 (6), E1002070 (2011)
   PUBMED   21695235
REFERENCE   2  (bases 1 to 813)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 813)
  AUTHORS   Aerts,A., Grimwood,J., Salamov,A., Schmutz,J., Tu,H., Shapiro,H.,
            Pitluck,S., Lucas,S., Goodwin,S.B., Ben M'Barek,S., Dhillon,B.,
            Wittenberg,A.H.J., Crane,C.F., Van der Lee,T.A.J., Antoniw,J.,
            Bailey,A., Bluhm,B., Bowler,J., Canto-Canche,B., Churchill,A.,
            Conde-Ferraez,L., Cools,H., Coutinho,P.M., Csukai,M., Dehal,P., De
            Wit,P., Donzelli,B., Foster,A.J., Hammond-Kosack,K., Hane,J.,
            Henrissat,B., Kilian,A., Koopmann,E., Kourmpetis,Y., Kuzniar,A.,
            Lindquist,E., Lombard,V., Maliepaard,C., Martins,N., Mehrabi,R.,
            Oliver,R., Ponomarenko,A., Rudd,J., Schouten,H.J.,
            Stergiopoulos,I., Torriani,S.F.F., de Vries,R.P., Wiebenga,A.,
            Zwiers,L.-H., Kema,G.H.J. and Grigoriev,I.V.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_018198).
            
            ##Metadata-START##
            Organism Display Name :: Mycosphaerella graminicola IPO323
            GOLD Stamp ID         :: Gi00795
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..813
                     /organism="Zymoseptoria tritici IPO323"
                     /mol_type="mRNA"
                     /strain="IPO323"
                     /type_material="culture from epitype of Septoria tritici"
                     /db_xref="taxon:336722"
                     /chromosome="21"
     gene            <1..>813
                     /locus_tag="MYCGRDRAFT_98091"
                     /db_xref="GeneID:13396643"
     CDS             1..813
                     /locus_tag="MYCGRDRAFT_98091"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003846856.1"
                     /db_xref="GeneID:13396643"
                     /db_xref="JGIDB:Mycgr3_98091"
                     /translation="

MAELDDEELADMGCFALRPLDDVDEVDGFEYKEDDGLDDVDEVDGFGYEEDDGLDDVDEVDGFGYEEDDGLDDVDEVDGFEYEEDDGLDDVDEVDGFEYEEDDGLDDVDEVDGFEYEEDDGLDDVDEVDGFEYEEDDGFDDEEDDGFNNGFSDSGSDDMSDNKMQDRELSPELGRSSFDQDEHVDRTETISFAPAVSQSQPAAATLQKPRYDPVRRFLLELGVQSFHGFPVWRSCRRLDEETLSARQRDYVDVSLDVCERRISADVGEEW"

     misc_feature    <112..>381
                     /locus_tag="MYCGRDRAFT_98091"
                     /note="RNA polymerase sigma factor; Provisional; Region:
                     PRK05901"
                     /db_xref="CDD:235640"
ORIGIN      

atggcagaactcgatgacgaggagctggctgacatgggatgctttgccttgcgtcccttggatgatgtcgatgaggtcgacggtttcgagtataaggaggacgatggcttggatgatgtcgatgaggtcgacggtttcgggtatgaggaggacgatggcttggatgatgtcgatgaggtcgacggtttcgggtatgaggaggacgatggcttggatgatgtcgatgaggtcgacggtttcgagtatgaggaggacgatggcttggatgatgtcgatgaggtcgacggtttcgagtatgaggaggacgatggcttggatgatgtcgatgaggtcgacggtttcgagtatgaggaggacgatggcttggatgatgtcgatgaggtcgatggtttcgagtatgaggaggacgatggcttcgatgatgaggaggacgacggcttcaacaacggcttttccgacagtggctctgacgacatgtccgacaataagatgcaggaccgcgagctgtctccagagctcggccgtagctcttttgatcaagatgagcatgttgatcgcaccgagaccatcagctttgctcctgcggtgtctcagtcgcagccggccgccgcaactctccaaaagccacgctacgacccagtacgcagattcttgctggagctgggcgtgcagagttttcatggttttccggtctggcgaagttgtcggcggctggacgaagagacgttgtcggcgaggcagcgagattatgtcgacgtcagtctcgatgtgtgcgagaggaggatttctgccgatgttggggaagaatggtga

//