2024-04-26 08:31:44, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_003843560 429 bp mRNA linear PLN 28-AUG-2017 DEFINITION Leptosphaeria maculans JN3 hypothetical protein (LEMA_P077180.1), partial mRNA. ACCESSION XM_003843560 VERSION XM_003843560.1 DBLINK BioProject: PRJNA171003 KEYWORDS RefSeq. SOURCE Plenodomus lingam JN3 ORGANISM Plenodomus lingam JN3 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Dothideomycetes; Pleosporomycetidae; Pleosporales; Pleosporineae; Leptosphaeriaceae; Plenodomus; Plenodomus lingam/Leptosphaeria maculans species complex. REFERENCE 1 (bases 1 to 429) AUTHORS Rouxel,T., Grandaubert,J., Hane,J.K., Hoede,C., van de Wouw,A.P., Couloux,A., Dominguez,V., Anthouard,V., Bally,P., Bourras,S., Cozijnsen,A.J., Ciuffetti,L.M., Degrave,A., Dilmaghani,A., Duret,L., Fudal,I., Goodwin,S.B., Gout,L., Glaser,N., Linglin,J., Kema,G.H., Lapalu,N., Lawrence,C.B., May,K., Meyer,M., Ollivier,B., Poulain,J., Schoch,C.L., Simon,A., Spatafora,J.W., Stachowiak,A., Turgeon,B.G., Tyler,B.M., Vincent,D., Weissenbach,J., Amselem,J., Quesneville,H., Oliver,R.P., Wincker,P., Balesdent,M.H. and Howlett,B.J. TITLE Effector diversification within compartments of the Leptosphaeria maculans genome affected by Repeat-Induced Point mutations JOURNAL Nat Commun 2, 202 (2011) PUBMED 21326234 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 429) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (28-AUG-2017) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 429) AUTHORS Genoscope -,C.E.A. TITLE Direct Submission JOURNAL Submitted (29-MAR-2010) to the INSDC. Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr) COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_003533876). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..429 /organism="Plenodomus lingam JN3" /mol_type="mRNA" /isolate="v23.1.3" /db_xref="taxon:985895" /chromosome="Unknown" gene <1..>429 /locus_tag="LEMA_P077180.1" /db_xref="GeneID:13292782" CDS 1..429 /locus_tag="LEMA_P077180.1" /codon_start=1 /product="hypothetical protein" /protein_id="XP_003843608.1" /db_xref="GeneID:13292782" /db_xref="UniProtKB/TrEMBL:E5A934" /translation="
MRYSLTLMGLATLGFHILPSLSAAVPASNLALRSNTIDKRHVYTVDEDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELAKRHVYGVDKDELA"
ORIGIN
atgcgttactctctcactctgatgggcctggccaccctcggcttccacatcctccccagtctttccgcagctgtgcctgcctctaacttggctctccgctctaacacgattgacaagcgtcatgtatacactgtcgacgaggatgagcttgccaagcgtcatgtatacggtgtcgacaaggacgagcttgctaagcgtcatgtctacggtgtcgacaaggatgagcttgctaagcgtcatgtctacggtgtcgacaaggatgagcttgccaagcgtcatgtctacggtgtcgacaaggacgagcttgccaagcgtcatgtctacggtgtcgacaaggatgagcttgccaagcgtcatgtctacggtgtcgacaaagatgagcttgccaagcgtcatgtctacggtgtcgacaaggatgagcttgcatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]