LOCUS       XM_003712973             150 bp    mRNA    linear   PLN 29-NOV-2019
DEFINITION  Pyricularia oryzae 70-15 uncharacterized protein (MGG_16933),
            partial mRNA.
ACCESSION   XM_003712973
VERSION     XM_003712973.1
DBLINK      BioProject: PRJNA1433
            BioSample: SAMN02953596
KEYWORDS    RefSeq.
SOURCE      Pyricularia oryzae 70-15
  ORGANISM  Pyricularia oryzae 70-15
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Magnaporthales;
            Pyriculariaceae; Pyricularia.
REFERENCE   1  (bases 1 to 150)
  AUTHORS   Dean,R.A., Talbot,N.J., Ebbole,D.J., Farman,M.L., Mitchell,T.K.,
            Orbach,M.J., Thon,M., Kulkarni,R., Xu,J.R., Pan,H., Read,N.D.,
            Lee,Y.H., Carbone,I., Brown,D., Oh,Y.Y., Donofrio,N., Jeong,J.S.,
            Soanes,D.M., Djonovic,S., Kolomiets,E., Rehmeyer,C., Li,W.,
            Harding,M., Kim,S., Lebrun,M.H., Bohnert,H., Coughlan,S.,
            Butler,J., Calvo,S., Ma,L.J., Nicol,R., Purcell,S., Nusbaum,C.,
            Galagan,J.E. and Birren,B.W.
  TITLE     The genome sequence of the rice blast fungus Magnaporthe grisea
  JOURNAL   Nature 434 (7036), 980-986 (2005)
   PUBMED   15846337
REFERENCE   2  (bases 1 to 150)
  AUTHORS   Ma,L.-J., Dean,R.A., Gowda,M., Nunes,C., Young,S.K., Zeng,Q.,
            Gargeya,S., Fitzgerald,M., Haas,B., Abouelleil,A., Alvarado,L.,
            Arachchi,H.M., Berlin,A., Brown,A., Chapman,S.B., Chen,Z.,
            Dunbar,C., Freedman,E., Gearin,G., Gellesch,M., Goldberg,J.,
            Griggs,A., Gujja,S., Heiman,D., Howarth,C., Larson,L., Lui,A.,
            MacDonald,P.J.P., Mehta,T., Montmayeur,A., Murphy,C., Neiman,D.,
            Pearson,M., Priest,M., Roberts,A., Saif,S., Shea,T., Shenoy,N.,
            Sisk,P., Stolte,C., Sykes,S., Yandava,C., Wortman,J., Nusbaum,C.
            and Birren,B.
  TITLE     The Genome Sequence of Magnaporthe oryzae 70-15
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 150)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (29-NOV-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 150)
  AUTHORS   Ma,L.-J., Dean,R.A., Gowda,M., Nunes,C., Young,S.K., Zeng,Q.,
            Gargeya,S., Fitzgerald,M., Haas,B., Abouelleil,A., Alvarado,L.,
            Arachchi,H.M., Berlin,A., Brown,A., Chapman,S.B., Chen,Z.,
            Dunbar,C., Freedman,E., Gearin,G., Gellesch,M., Goldberg,J.,
            Griggs,A., Gujja,S., Heiman,D., Howarth,C., Larson,L., Lui,A.,
            MacDonald,P.J.P., Mehta,T., Montmayeur,A., Murphy,C., Neiman,D.,
            Pearson,M., Priest,M., Roberts,A., Saif,S., Shea,T., Shenoy,N.,
            Sisk,P., Stolte,C., Sykes,S., Yandava,C., Wortman,J., Nusbaum,C.
            and Birren,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2011) Broad Institute of MIT and Harvard, 7
            Cambridge Center, Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_017849).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..150
                     /organism="Pyricularia oryzae 70-15"
                     /mol_type="mRNA"
                     /strain="70-15"
                     /db_xref="taxon:242507"
                     /chromosome="3"
     gene            <1..>150
                     /locus_tag="MGG_16933"
                     /db_xref="GeneID:12985896"
     CDS             1..150
                     /locus_tag="MGG_16933"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_003713021.1"
                     /db_xref="GeneID:12985896"
                     /translation="

MKSPRKAERHSYQTPPTAKKMSEWCLDLLSRLVLELDLERDAVDRLWFN"

ORIGIN      

atgaagtcccctcgcaaagccgagcgacactcgtaccagacaccgcccacggcaaagaagatgtccgagtggtgtcttgacttactctcacgtcttgttttggagctcgaccttgaacgtgatgccgtcgaccggttgtggttcaactag

//