2025-07-16 04:13:38, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_003644656 303 bp mRNA linear PLN 04-DEC-2024 DEFINITION Eremothecium cymbalariae DBVPG#7215 60S ribosomal protein eL36 (Ecym_2135), partial mRNA. ACCESSION XM_003644656 VERSION XM_003644656.1 DBLINK BioProject: PRJNA78153 BioSample: SAMN03081426 KEYWORDS RefSeq. SOURCE Eremothecium cymbalariae DBVPG#7215 ORGANISM Eremothecium cymbalariae DBVPG#7215 Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Eremothecium. REFERENCE 1 (bases 1 to 303) AUTHORS Wendland,J. and Walther,A. TITLE Genome evolution in the eremothecium clade of the Saccharomyces complex revealed by comparative genomics JOURNAL G3 (Bethesda) 1 (7), 539-548 (2011) PUBMED 22384365 REFERENCE 2 (bases 1 to 303) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (03-DEC-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 303) AUTHORS Wendland,J. TITLE Direct Submission JOURNAL Submitted (04-FEB-2011) Yeast Biology, Carlsberg Laboratory, Gamle Carlsberg Vej 10, Copenhagen V DK-1899, Denmark COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NC_016450). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..303 /organism="Eremothecium cymbalariae DBVPG#7215" /mol_type="mRNA" /strain="DBVPG#7215" /db_xref="taxon:931890" /chromosome="2" gene <1..>303 /locus_tag="Ecym_2135" /db_xref="GeneID:11471800" CDS 1..303 /locus_tag="Ecym_2135" /note="similar to Ashbya gossypii AFL163C 1-intron" /codon_start=1 /product="60S ribosomal protein eL36" /protein_id="XP_003644704.1" /db_xref="GeneID:11471800" /translation="
MAVKSGIAVGLNKGKKVNSMTPAPKISYRKGASSKRTEFVRSIVKEVAGLAPYERRLLDLIRNSGEKRARKVAKKRLGTFGRAKAKVEEMNNVIAASRRH"
misc_feature 10..297 /locus_tag="Ecym_2135" /note="Ribosomal protein L36e; Region: Ribosomal_L36e; pfam01158" /db_xref="CDD:460088" ORIGIN
atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaactcgatgaccccagccccaaagatctcttacagaaagggtgcttcttccaagagaacggagtttgttagatctattgtcaaggaagtcgccgggttggctccatacgagagaagattgcttgatttgatcagaaactctggtgagaagagagccagaaaggttgccaagaagagattgggtacttttggcagagcaaaggctaaggttgaagaaatgaacaacgtcattgctgcttccagacgtcactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]