GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-23 04:09:13, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_002999537             303 bp    mRNA    linear   PLN 25-SEP-2017
DEFINITION  [Candida] glabrata 60S ribosomal protein L36 (CAGL0K10906g),
            partial mRNA.
ACCESSION   XM_002999537
VERSION     XM_002999537.1
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
KEYWORDS    RefSeq.
SOURCE      [Candida] glabrata (Candida glabrata)
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_006034).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="[Candida] glabrata"
                     /mol_type="mRNA"
                     /strain="CBS 138"
                     /db_xref="taxon:5478"
                     /chromosome="K"
     gene            <1..>303
                     /locus_tag="CAGL0K10906g"
                     /db_xref="GeneID:9488035"
     CDS             1..303
                     /locus_tag="CAGL0K10906g"
                     /note="highly similar to uniprot|O14455 Saccharomyces
                     cerevisiae YPL249ca RPL36B or uniprot|P05745 Saccharomyces
                     cerevisiae YMR194w RPL36A"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_002999583.1"
                     /db_xref="GeneID:9488035"
                     /db_xref="GOA:B4UN40"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:B4UN40"
                     /translation="
MAVKTGIAVGLNKGTKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNAGEKRARKVAKKRLGSFTRAKAKVEEMNSIIAASRRH"
     misc_feature    10..297
                     /locus_tag="CAGL0K10906g"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:307352"
ORIGIN      
atggccgttaagactggtattgctgttggtttgaacaagggtactaaggtcacccaaatgaccccagccccaaagatctcttacaagaagggtgctgcttctaacagaaccaagttcgttcgttctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagctaaggctaaggttgaagaaatgaactccatcattgctgcttctcgtcgtcactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]