LOCUS       XM_002902419             396 bp    mRNA    linear   PLN 26-JAN-2024
DEFINITION  Phytophthora infestans T30-4 secreted RxLR effector peptide
            protein, putative (PITG_09915), partial mRNA.
ACCESSION   XM_002902419
VERSION     XM_002902419.1
DBLINK      BioProject: PRJNA49677
            BioSample: SAMN02953670
KEYWORDS    RefSeq.
SOURCE      Phytophthora infestans T30-4
  ORGANISM  Phytophthora infestans T30-4
            Eukaryota; Sar; Stramenopiles; Oomycota; Peronosporomycetes;
            Peronosporales; Peronosporaceae; Phytophthora.
REFERENCE   1  (bases 1 to 396)
  AUTHORS   Nusbaum,C., Haas,B., Kamoun,S., Fry,W., Judelson,H., Ristaino,J.,
            Govers,F., Whisson,S., Birch,P., Birren,B., Lander,E., Galagan,J.,
            Zody,M., Devon,K., O'Neil,K., Zembek,L., Anderson,S., Jaffe,D.,
            Butler,J., Alvarez,P., Gnerre,S., Grabherr,M., Mauceli,E.,
            Brockman,W., Young,S., LaButti,K., Sykes,S., DeCaprio,D.,
            Crawford,M., Koehrsen,M., Engels,R., Montgomery,P., Pearson,M.,
            Howarth,C., Larson,L., White,J., O'Leary,S., Kodira,C., Zeng,Q.,
            Yandava,C. and Alvarado,L.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     Annotation of Phytophthora infestans T30-4
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 396)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-JAN-2024) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 396)
  AUTHORS   Nusbaum,C., Kamoun,S., Fry,W., Judelson,H., Ristaino,J., Govers,F.,
            Whisson,S., Birch,P., Birren,B., Lander,E., Galagan,J., Zody,M.,
            Devon,K., O'Neil,K., Zembek,L., Anderson,S., Jaffe,D., Butler,J.,
            Alvarez,P., Gnerre,S., Grabherr,M., Mauceli,E., Brockman,W.,
            Young,S., LaButti,K., Sykes,S., DeCaprio,D., Crawford,M.,
            Koehrsen,M., Engels,R., Montgomery,P., Pearson,M., Howarth,C.,
            Larson,L., White,J., O'Leary,S., Kodira,C., Zeng,Q., Yandava,C. and
            Alvarado,L.
  CONSRTM   The Broad Institute Genome Sequencing Platform
  TITLE     Direct Submission
  JOURNAL   Submitted (23-OCT-2006) Broad Institute of MIT and Harvard, 7
            Cambridge Center, Cambridge, MA 02142, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_003303742).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..396
                     /organism="Phytophthora infestans T30-4"
                     /mol_type="mRNA"
                     /strain="T30-4"
                     /type_material="culture from epitype of Botrytis
                     infestans"
                     /db_xref="taxon:403677"
                     /chromosome="Unknown"
     gene            <1..>396
                     /locus_tag="PITG_09915"
                     /db_xref="GeneID:9474690"
     CDS             1..396
                     /locus_tag="PITG_09915"
                     /codon_start=1
                     /product="secreted RxLR effector peptide protein,
                     putative"
                     /protein_id="XP_002902465.1"
                     /db_xref="GeneID:9474690"
                     /translation="

MRISFMLSVAMATLYFAICNATGDFNPITLSAMGSPELVHTLDEVRSDAGTPKRYLRVHGKDGETGAEERGLGELMAKIKYMVENADLRSLLKAILDEILKADDGYRTWVALRYNAHGAGELLNLWSPRRD"

     misc_feature    1..>342
                     /locus_tag="PITG_09915"
                     /note="RXLR phytopathogen effector protein, Avirulence
                     activity; Region: RXLR; pfam16810"
                     /db_xref="CDD:465277"
ORIGIN      

atgcgtatctcattcatgctgtctgttgcgatggctaccctctactttgcgatctgtaacgcgactggagacttcaatccaatcacgctgtcagcaatgggatcgccagagctcgtccacacgcttgacgaagtgcgcagcgacgctgggaccccgaaaagatatttacgagtacacggaaaggatggagaaaccggagcggaggagcgaggtcttggtgaactaatggctaagattaaatacatggtggagaatgcagacctcagatcattgcttaaggcaatcctggatgaaatattaaaggccgatgacgggtataggacttgggtggcgcttcggtataacgcacacggcgctggcgagctgttgaacttatggtctccaagaagagattga

//