2024-05-20 10:50:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_002783056 417 bp mRNA linear INV 30-APR-2010 DEFINITION Perkinsus marinus ATCC 50983 copper-transporting ATPase p-type ATPase, putative, mRNA. ACCESSION XM_002783056 VERSION XM_002783056.1 KEYWORDS RefSeq. SOURCE Perkinsus marinus ATCC 50983 ORGANISM Perkinsus marinus ATCC 50983 Eukaryota; Sar; Alveolata; Perkinsozoa; Perkinsea; Perkinsida; Perkinsidae; Perkinsus. REFERENCE 1 (bases 1 to 417) AUTHORS El-Sayed,N., Caler,E., Inman,J., Amedeo,P., Hass,B. and Wortman,J. TITLE Direct Submission JOURNAL Submitted (09-JUL-2008) J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_003213814). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..417 /organism="Perkinsus marinus ATCC 50983" /mol_type="mRNA" /strain="ATCC 50983" /culture_collection="ATCC:50983" /db_xref="taxon:423536" /note="strain co-identity: ATCC 50983 = PmCV4CB5 2B3 D4" gene <1..>417 /locus_tag="Pmar_PMAR022061" /db_xref="GeneID:9061753" /db_xref="VectorBase:PMAR022061" CDS 1..417 /locus_tag="Pmar_PMAR022061" /note="encoded by transcript Pmar_PMAR022061-RA" /codon_start=1 /product="copper-transporting ATPase p-type ATPase, putative" /protein_id="XP_002783102.1" /db_xref="VectorBase:PMAR022061-PA" /db_xref="GeneID:9061753" /db_xref="VectorBase:PMAR022061" /translation="
MVGDGVNDGPALAAADVGVAVGSGVDVSTEAAHVVIHSLRGLAPFIELSRQTLKTIWRNLFWAFIFNIIMLPLAAGILYPSTGITLPPEVAGAAMACSSLVVVTNSLSIQYWTKSRYGHDEQLTKAIREATSGQAGKE"
misc_feature <1..321 /locus_tag="Pmar_PMAR022061" /note="Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl21460" /db_xref="CDD:451251" ORIGIN
atggtcggtgatggcgtcaatgatggccctgcactggcagcagcagatgttggagtagctgttggctcgggtgttgacgtgtctactgaagccgcccatgtggttatccacagcctcagaggcttagcgccgttcatcgaactctcgaggcaaacactaaagactatttggcgtaatctcttctgggctttcatattcaacattattatgctgcccttggctgccggtattctgtatccctccactggcattactctccctcccgaggtggcaggagcagccatggcatgcagctctctagtggtcgtcaccaactctctcagcattcaatattggactaagtcgaggtatggccacgatgagcaacttacgaaggcgatccgggaagcgacaagtggccaggctgggaaggagtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]