GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-20 10:50:43, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_002783056             417 bp    mRNA    linear   INV 30-APR-2010
DEFINITION  Perkinsus marinus ATCC 50983 copper-transporting ATPase p-type
            ATPase, putative, mRNA.
ACCESSION   XM_002783056
VERSION     XM_002783056.1
KEYWORDS    RefSeq.
SOURCE      Perkinsus marinus ATCC 50983
  ORGANISM  Perkinsus marinus ATCC 50983
            Eukaryota; Sar; Alveolata; Perkinsozoa; Perkinsea; Perkinsida;
            Perkinsidae; Perkinsus.
REFERENCE   1  (bases 1 to 417)
  AUTHORS   El-Sayed,N., Caler,E., Inman,J., Amedeo,P., Hass,B. and Wortman,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUL-2008) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_003213814).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..417
                     /organism="Perkinsus marinus ATCC 50983"
                     /mol_type="mRNA"
                     /strain="ATCC 50983"
                     /culture_collection="ATCC:50983"
                     /db_xref="taxon:423536"
                     /note="strain co-identity: ATCC 50983 = PmCV4CB5 2B3 D4"
     gene            <1..>417
                     /locus_tag="Pmar_PMAR022061"
                     /db_xref="GeneID:9061753"
                     /db_xref="VectorBase:PMAR022061"
     CDS             1..417
                     /locus_tag="Pmar_PMAR022061"
                     /note="encoded by transcript Pmar_PMAR022061-RA"
                     /codon_start=1
                     /product="copper-transporting ATPase p-type ATPase,
                     putative"
                     /protein_id="XP_002783102.1"
                     /db_xref="VectorBase:PMAR022061-PA"
                     /db_xref="GeneID:9061753"
                     /db_xref="VectorBase:PMAR022061"
                     /translation="
MVGDGVNDGPALAAADVGVAVGSGVDVSTEAAHVVIHSLRGLAPFIELSRQTLKTIWRNLFWAFIFNIIMLPLAAGILYPSTGITLPPEVAGAAMACSSLVVVTNSLSIQYWTKSRYGHDEQLTKAIREATSGQAGKE"
     misc_feature    <1..321
                     /locus_tag="Pmar_PMAR022061"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:451251"
ORIGIN      
atggtcggtgatggcgtcaatgatggccctgcactggcagcagcagatgttggagtagctgttggctcgggtgttgacgtgtctactgaagccgcccatgtggttatccacagcctcagaggcttagcgccgttcatcgaactctcgaggcaaacactaaagactatttggcgtaatctcttctgggctttcatattcaacattattatgctgcccttggctgccggtattctgtatccctccactggcattactctccctcccgaggtggcaggagcagccatggcatgcagctctctagtggtcgtcaccaactctctcagcattcaatattggactaagtcgaggtatggccacgatgagcaacttacgaaggcgatccgggaagcgacaagtggccaggctgggaaggagtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]