GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-03-28 22:36:51, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       XM_002775004             153 bp    mRNA    linear   INV 30-APR-2010
DEFINITION  Perkinsus marinus ATCC 50983 hypothetical protein, mRNA.
ACCESSION   XM_002775004
VERSION     XM_002775004.1
KEYWORDS    RefSeq.
SOURCE      Perkinsus marinus ATCC 50983
  ORGANISM  Perkinsus marinus ATCC 50983
            Eukaryota; Sar; Alveolata; Perkinsozoa; Perkinsea; Perkinsida;
            Perkinsidae; Perkinsus.
REFERENCE   1  (bases 1 to 153)
  AUTHORS   El-Sayed,N., Caler,E., Inman,J., Amedeo,P., Hass,B. and Wortman,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JUL-2008) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_003207247).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..153
                     /organism="Perkinsus marinus ATCC 50983"
                     /mol_type="mRNA"
                     /strain="ATCC 50983"
                     /culture_collection="ATCC:50983"
                     /db_xref="taxon:423536"
                     /note="strain co-identity: ATCC 50983 = PmCV4CB5 2B3 D4"
     gene            <1..>153
                     /locus_tag="Pmar_PMAR027179"
                     /db_xref="GeneID:9057059"
                     /db_xref="VectorBase:PMAR027179"
     CDS             <1..>153
                     /locus_tag="Pmar_PMAR027179"
                     /note="encoded by transcript Pmar_PMAR027179-RA"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002775050.1"
                     /db_xref="VectorBase:PMAR027179-PA"
                     /db_xref="GeneID:9057059"
                     /db_xref="VectorBase:PMAR027179"
                     /translation="
ICFDCWHNTWHSKEYIALTLNVHTDKPTPVVLDLREIPDGTSESLKMAIDE"
ORIGIN      
atatgcttcgattgctggcacaacacgtggcacagcaaggagtacatcgccttgaccttgaacgtgcacacggacaaacctactccagtcgtgttagacctgagagaaataccagacggtaccagtgagagcctcaagatggcgatagatgaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]