GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2019-03-25 14:41:41, GGRNA.v2 : RefSeq release 92 (Jan, 2019)

LOCUS       XM_002555947             303 bp    mRNA    linear   PLN 05-JUN-2017
DEFINITION  Lachancea thermotolerans CBS 6340 60S ribosomal protein L36 partial
            mRNA.
ACCESSION   XM_002555947
VERSION     XM_002555947.1
DBLINK      BioProject: PRJNA39575
            BioSample: SAMEA3138300
KEYWORDS    RefSeq.
SOURCE      Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS
            6340)
  ORGANISM  Lachancea thermotolerans CBS 6340
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 303)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_013084).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Lachancea thermotolerans CBS 6340"
                     /mol_type="mRNA"
                     /strain="CBS 6340"
                     /db_xref="taxon:559295"
                     /chromosome="H"
     gene            <1..>303
                     /locus_tag="KLTH0H02596g"
                     /db_xref="GeneID:8294306"
     CDS             1..303
                     /locus_tag="KLTH0H02596g"
                     /note="highly similar to uniprot|P05745 Saccharomyces
                     cerevisiae YMR194W RPL36A and to uniprot|O14455
                     Saccharomyces cerevisiae YPL249C-A RPL36B Proteins
                     component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_002555993.1"
                     /db_xref="GeneID:8294306"
                     /db_xref="GOA:C5E270"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:C5E270"
                     /translation="
MAVKSGIATGLNKGKKVTQMTPAPKISYRKGASSNRTKFVRSLVKEVAGLAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNDIITASRRH"
     misc_feature    10..297
                     /locus_tag="KLTH0H02596g"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:279499"
ORIGIN      
atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcacccagatgaccccagccccaaagatctcgtacagaaagggtgcttcctctaacagaaccaagttcgtcagatctttggtcaaggaggtcgccggtttggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggtactttcggcagagccaaggctaaggtcgaggagatgaacgacatcatcaccgcctctcgtcgtcactaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]