2025-10-16 11:31:15, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_002141116 372 bp mRNA linear INV 06-DEC-2023 DEFINITION Cryptosporidium muris RN66 prefoldin subunit 2, putative (CMU_014790), partial mRNA. ACCESSION XM_002141116 VERSION XM_002141116.1 DBLINK BioProject: PRJNA32283 BioSample: SAMN02953683 KEYWORDS RefSeq. SOURCE Cryptosporidium muris RN66 ORGANISM Cryptosporidium muris RN66 Eukaryota; Sar; Alveolata; Apicomplexa; Conoidasida; Coccidia; Eucoccidiorida; Eimeriorina; Cryptosporidiidae; Cryptosporidium. REFERENCE 1 (bases 1 to 372) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (05-DEC-2023) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 2 (bases 1 to 372) AUTHORS Lorenzi,H., Inman,J., Miller,J., Schobel,S., Amedeo,P., Caler,E.V. and da Silva,J. TITLE Direct Submission JOURNAL Submitted (23-JUN-2008) J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_002196574). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..372 /organism="Cryptosporidium muris RN66" /mol_type="mRNA" /strain="RN66" /db_xref="taxon:441375" /chromosome="Unknown" gene <1..>372 /locus_tag="CMU_014790" /db_xref="GeneID:6996218" CDS 1..372 /locus_tag="CMU_014790" /note="encoded by transcript CMU_014790A; weak similarity to SP:Q9UHV9: Prefoldin subunit 2. taxon:9606 {Homo sapiens;}" /codon_start=1 /product="prefoldin subunit 2, putative" /protein_id="XP_002141152.1" /db_xref="GeneID:6996218" /translation="
MVETGYTKETQEEIVQLDKKLKLLNNKISELTQDSKEYGLVLNAFEKVDENRRCFRVIGGVMVERNVKTVKPALEKEKSALDSAISELEKQYESIEEEMKNLIEKYSTNSADPAQITSSSSSQ"
misc_feature 25..318 /locus_tag="CMU_014790" /note="prefoldin subunit 2; Region: Prefoldin_2; cd23163" /db_xref="CDD:467479" misc_feature 25..144 /locus_tag="CMU_014790" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:467479" misc_feature order(28..30,40..42,49..54,61..66,70..75,82..87,94..96, 256..258,265..267,277..279,289..291,298..303,310..315) /locus_tag="CMU_014790" /note="prefoldin beta subunit /TRiC interface [polypeptide binding]; other site" /db_xref="CDD:467479" misc_feature order(121..123,130..132,142..147,154..174,178..195, 205..210,220..222) /locus_tag="CMU_014790" /note="prefoldin oligomer interface [polypeptide binding]; other site" /db_xref="CDD:467479" misc_feature 202..318 /locus_tag="CMU_014790" /note="coiled coil [structural motif]; Region: coiled coil" /db_xref="CDD:467479" ORIGIN
atggttgagacaggatatactaaggagacacaagaagagattgttcaactagataagaaactcaaactactaaacaataagatttcagagcttactcaagatagtaaagagtatggtctagtcttaaatgcatttgagaaggtagacgagaaccgacgatgttttagagttattggtggtgtgatggttgagagaaatgttaaaactgttaaacctgctcttgaaaaagaaaagagtgcgttagatagtgcaatttccgaattagagaagcagtatgaatctattgaagaggaaatgaagaatctaattgagaaatatagtacaaatagtgctgatcctgcacaaataactagttcatcaagctcgcaataa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]