2024-05-20 10:50:27, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS XM_001628563 1194 bp mRNA linear INV 21-JUN-2022 DEFINITION PREDICTED: Nematostella vectensis spidroin-2 (LOC5508030), mRNA. ACCESSION XM_001628563 VERSION XM_001628563.3 DBLINK BioProject: PRJNA847078 KEYWORDS RefSeq; includes ab initio. SOURCE Nematostella vectensis (starlet sea anemone) ORGANISM Nematostella vectensis Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Actiniaria; Edwardsiidae; Nematostella. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_064040) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Jun 21, 2022 this sequence version replaced XM_001628563.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Nematostella vectensis Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 9.0 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 38% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1194 /organism="Nematostella vectensis" /mol_type="mRNA" /db_xref="taxon:45351" /chromosome="7" gene 1..1194 /gene="LOC5508030" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 61% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns" /db_xref="GeneID:5508030" CDS 1..1194 /gene="LOC5508030" /codon_start=1 /product="spidroin-2" /protein_id="XP_001628613.3" /db_xref="GeneID:5508030" /translation="
MWMYSRNHTQQGKQCPCIMTGPTQQGNQCPCNMAGPTQQGNQCPCNMAGPTQQGKQCPCVMPGPTQQGKQCPCNMAGPTQQRNQCPCNMAGPIQQGNQFPCNMAGPTQQGNQCPCNMADPTQQGNKCPCVMPGPTQQGKQCPCNMAEPTQQGKQCPCNMAGPTQQGNQFPCNMAGPTQQGKQCPCVMAGPTQQGNQCPCNMAGPTQQGNQCPCNMAGPTQQGNHCPCNMAGPTQQGNQFPCNMAGPTQQGNQCHYNMADSTQHDEQCHVVVGFMTADKAASNIHLSSEEVCARFLGQLDTIFGTPEDPRPASDNLVNYVYYHWSKHPYVRGGYSSPTALAHGLRHHLASPVSGRLFFAGEATNVKVSATVPSAIEWGESGGGGATASIEELSAEGTH"
misc_feature <298..648 /gene="LOC5508030" /note="60S ribosomal protein L19-like protein; Provisional; Region: PTZ00436" /db_xref="CDD:185616" misc_feature <748..1125 /gene="LOC5508030" /note="Flavin containing amine oxidoreductase; Region: Amino_oxidase; pfam01593" /db_xref="CDD:396255" ORIGIN
atgtggatgtattccaggaatcacacccaacaagggaagcagtgcccctgtatcatgactggccccacccaacaagggaaccagtgcccctgtaacatggctggccccacccaacaagggaaccagtgcccctgtaacatggctggccccacccaacaagggaagcagtgcccctgtgtcatgcctggccccacccaacaagggaagcagtgcccctgtaacatggctggccccacccaacaaaggaaccagtgcccctgtaacatggctggccccatccaacaagggaaccagttcccctgtaacatggctggccccacccaacaagggaaccagtgcccctgtaacatggctgaccccacccaacaagggaacaagtgcccctgtgtcatgcctggccccacccaacaagggaagcagtgcccctgtaacatggctgaacccacccaacaagggaagcagtgcccctgtaacatggctggccccacccaacaagggaaccagttcccctgtaacatggctggccccacccaacaagggaagcagtgcccctgtgtcatggctggcccaacccaacaaggaaaccagtgcccctgtaacatggctggccccacccaacaaggaaaccagtgcccctgtaacatggctggccccacccaacaagggaaccattgcccctgtaacatggctggccccacccaacaagggaaccagttcccctgtaacatggctggccccacccaacaagggaaccagtgccattataacatggctgactccacccaacatgatgaacagtgtcacgtggttgtgggttttatgaccgctgacaaggcggcatcgaatattcacctgtctagtgaagaagtgtgtgccagattcctggggcaactggataccatttttgggacccctgaggacccccgaccagcctctgacaacctggtcaactacgtgtactatcattggtccaaacacccctacgtcagaggtggctacagcagtccgactgcgcttgcgcacggcctacggcaccatctagctagtccggtcagcggtcgactgtttttcgcgggagaggcaacgaatgtcaaggtctctgccaccgtcccttcggcgatagagtggggagagagcggcggagggggtgctacagcaagcattgaggagttgtcagcggagggtacccattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]