ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-01-25 21:21:24, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_001391587 777 bp mRNA linear PLN 21-FEB-2025
DEFINITION Aspergillus niger uncharacterized protein (An07g05440), partial
mRNA.
ACCESSION XM_001391587
VERSION XM_001391587.1
DBLINK BioProject: PRJNA19263
BioSample: SAMEA3283178
KEYWORDS RefSeq.
SOURCE Aspergillus niger
ORGANISM Aspergillus niger
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
Aspergillus; Aspergillus subgen. Circumdati.
REFERENCE 1 (bases 1 to 777)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (21-FEB-2025) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NT_166523).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..777
/organism="Aspergillus niger"
/mol_type="mRNA"
/db_xref="taxon:5061"
/chromosome="IV"
/map="unlocalized"
/clone="An07"
gene <1..>777
/locus_tag="An07g05440"
/db_xref="GeneID:4981811"
CDS 1..777
/locus_tag="An07g05440"
/EC_number="1.1.1.-"
/inference="profile:COGS:COG1028"
/inference="profile:PFAM:PF00106"
/note="Function: maleylacetate reductases contribute to
the bacterial catabolism of some usual aromatic compounds
like quinol or resorcinol and also to the degradation of
aromatic compounds carrying unusual substituents, such as
halogen atoms or nitro groups.;
Similarity: the ORF shows similarity to several
short-chain dehydrogenase/reductase from different species
and with various function, most of which are
3-oxoacyl-(acyl carrier protein) reductases, that are
involved in fatty acid biosynthesis (EC 1. 1. 1. 100).;
Title: strong similarity to maleylacetate reductase macA -
Rhodococcus opacus"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_001391624.1"
/db_xref="GeneID:4981811"
/db_xref="GOA:A2QNF1"
/db_xref="InterPro:IPR002347"
/db_xref="InterPro:IPR016040"
/db_xref="UniProtKB/TrEMBL:A2QNF1"
/translation="
MSSGSYNYNKLAGKHVLIFGGTSGIGLGVAKLSLAASAKVTVSSSSSKRIESTVQDLKSEFPNAQLQGHVCDLSKDTIEEDFEALFQKTNQVDHIVFTATDAPAIMPVQEITREKLIAAGQVRFFAAVLVAKIGSRYLSPGPDSSITLTTGTNWEHPMPNWTAVAGYLGGTCSVVCNLAVDLKPIRVNAVSPGLVKTPLWNNLMSEEEQEKICQFSAAKNPTGRVAQPEEVAEAYLYLMKDTNITGRIVSTDSGALLV"
misc_feature 49..774
/locus_tag="An07g05440"
/note="SDR family oxidoreductase; Region: PRK07041"
/db_xref="CDD:235914"
ORIGIN
atgtcctccggcagctacaactacaataaactcgcgggcaagcatgtcctgattttcggaggcacctccggcataggcctgggtgtggccaagctttcactagccgcatcagccaaagtcactgtgtcttcatcctcaagcaaacgcattgaatccaccgtccaggatctcaagtcggaattcccaaatgcccagctccaaggacacgtctgcgatctttccaaagacacgatcgaagaagacttcgaagcgctattccaaaagaccaaccaagttgatcacattgttttcaccgcaaccgatgcgccagccatcatgcccgtgcaagaaatcactcgggagaagctcatcgctgccggtcaagtgcgctttttcgcggccgtactcgtcgccaagattggctctcgatacctctccccgggtccggattcatcaattaccttgacgacaggaactaattgggaacatccgatgcccaactggacggcggtagctggatacttaggtggtacttgcagtgttgtgtgtaatctagcggtggatttgaagccgatacgtgttaacgctgtgagtcctggactggtgaaaactcccctatggaacaatctgatgagtgaagaggagcaagaaaagatatgccagttttccgcagcgaaaaatccgacgggaagggttgctcagccggaagaagtggcagaggcttatctatatttgatgaaggatacgaacattaccgggcggatagtgagtacggattcgggtgctttacttgtttaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]