LOCUS       XM_001383429             288 bp    mRNA    linear   PLN 05-JUN-2017
DEFINITION  Scheffersomyces stipitis CBS 6054 60S ribosomal protein L36 partial
            mRNA.
ACCESSION   XM_001383429
VERSION     XM_001383429.1
DBLINK      BioProject: PRJNA18881
            BioSample: SAMN02746101
KEYWORDS    RefSeq.
SOURCE      Scheffersomyces stipitis CBS 6054 (Pichia stipitis CBS 6054)
  ORGANISM  Scheffersomyces stipitis CBS 6054
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Debaryomycetaceae;
            Scheffersomyces.
REFERENCE   1  (bases 1 to 288)
  AUTHORS   Jeffries,T.W., Grigoriev,I.V., Grimwood,J., Laplaza,J.M., Aerts,A.,
            Salamov,A., Schmutz,J., Lindquist,E., Dehal,P., Shapiro,H.,
            Jin,Y.S., Passoth,V. and Richardson,P.M.
  TITLE     Genome sequence of the lignocellulose-bioconverting and
            xylose-fermenting yeast Pichia stipitis
  JOURNAL   Nat. Biotechnol. 25 (3), 319-326 (2007)
   PUBMED   17334359
REFERENCE   2  (bases 1 to 288)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 288)
  AUTHORS   Grigoriev,I., Grimwood,J., Aerts,A., Salamov,A., Zhou,K., Lou,Y.,
            Pitluck,S., Schmutz,J., Myers,R.M., Lucas,S., Detter,J.C., Glavina
            del Rio,T., Jin,Y.-S., Passoth,V., Laplaza,J.M., Jeffries,T.W. and
            Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2006) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_009043).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..288
                     /organism="Scheffersomyces stipitis CBS 6054"
                     /mol_type="mRNA"
                     /strain="CBS 6054"
                     /db_xref="taxon:322104"
                     /chromosome="3"
     gene            <1..>288
                     /locus_tag="PICST_43155"
                     /db_xref="GeneID:4838027"
     CDS             <1..288
                     /locus_tag="PICST_43155"
                     /note="go_component intracellular; ribosome;
                     go_function structural constituent of ribosome;
                     go_process protein biosynthesis"
                     /codon_start=1
                     /transl_table=12
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_001383466.1"
                     /db_xref="GeneID:4838027"
                     /db_xref="InterPro:IPR00050"
                     /db_xref="JGIDB:Picst3_43155"
                     /translation="

GIAVGLNKGHKTTAKEVAPKISYRKGALSKRTDFVRNIVKEVAGLAPYERRLIELIRNAGEKRAKKLAKKRLGTHKRALKKVEEMNKVIAETRRH"

     misc_feature    1..282
                     /locus_tag="PICST_43155"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:426088"
ORIGIN      

ggaattgctgttggattaaacaagggtcacaagactaccgctaaggaagttgctccaaagatctcttacagaaagggtgctctttccaagagaaccgacttcgtcagaaacatcgtcaaggaagttgctggcttagccccatacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagaaatgaacaaggtcattgctgaaaccagaagacactaa

//