2021-01-24 05:53:26, GGRNA.v2 : RefSeq release 203 (Nov, 2020)
LOCUS XM_001263935 1410 bp mRNA linear PLN 20-AUG-2020 DEFINITION Aspergillus fischeri NRRL 181 PAZ domain protein (NFIA_024180), partial mRNA. ACCESSION XM_001263935 VERSION XM_001263935.1 DBLINK BioProject: PRJNA18475 BioSample: SAMN02953637 KEYWORDS RefSeq. SOURCE Aspergillus fischeri NRRL 181 (Neosartorya fischeri NRRL 181) ORGANISM Aspergillus fischeri NRRL 181 Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus; Aspergillus subgen. Fumigati. REFERENCE 1 (bases 1 to 1410) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (20-AUG-2020) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 2 (bases 1 to 1410) AUTHORS Nierman,W.C. TITLE Direct Submission JOURNAL Submitted (26-OCT-2006) The Institute for Genomic Research, 9712 Medical Center Drive, Rockville, MD 20850, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_001509769). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..1410 /organism="Aspergillus fischeri NRRL 181" /mol_type="mRNA" /strain="NRRL 181" /type_material="culture from neotype of Aspergillus fischeri" /db_xref="taxon:331117" /chromosome="Unknown" gene <1..>1410 /locus_tag="NFIA_024180" /db_xref="GeneID:4590588" CDS 1..1410 /locus_tag="NFIA_024180" /note="encoded by transcript NFIA_024180A; predicted by EVM" /codon_start=1 /product="PAZ domain protein" /protein_id="XP_001263936.1" /db_xref="GeneID:4590588" /translation="
MEDYKHQNKLTGGLRHLHVDTTDDVAKYTISVKTVTRPNHRQTGKEIEVLMNAYPITKFPTCNVYQYDVQIRNGVEKNIIIKKVWNSNARKAALKQIIFDGQKLAWSMNNYSNSLNMVVDLNQEQGRPAGRTSNTFHLTVRRKTVNLAVLNAWLTGRTSMSEAVLEAMNFLDHVLREHPSGKFLALRRSFFDEKGDNQDLGNGVLAFKGVYQAIRPALGRGLIVNVDVSNSCFWARTSFMGAAMVVLDCRDHQHLMHVLKPISDGYGGVTKSTSFYKVHRRLQKLGVQPHYRGCPCTGVDFTVKGLLHANARQYMIKIKDKATGKTEKMSVEAYFKKKYNLTLNYWELPMVEMTKKGVVYLMEVLTIHRLHRYPWKLNEYQTSVMIKYAASRPADHLNSIYKLKAILNHAKDPVLNTFGLAIKDDMIRTKARLLPSPDIQFGGNQCLSPGTNGHWDLCGKKFYQPTRDH"
misc_feature 109..525 /locus_tag="NFIA_024180" /note="N-terminal domain of argonaute; Region: ArgoN; pfam16486" /db_xref="CDD:293095" misc_feature 559..702 /locus_tag="NFIA_024180" /note="Argonaute linker 1 domain; Region: ArgoL1; pfam08699" /db_xref="CDD:285861" misc_feature 754..1104 /locus_tag="NFIA_024180" /note="PAZ domain, argonaute_like subfamily. Argonaute is part of the RNA-induced silencing complex (RISC), and is an endonuclease that plays a key role in the RNA interference pathway. The PAZ domain has been named after the proteins Piwi,Argonaut, and Zwille; Region: PAZ_argonaute_like; cd02846" /db_xref="CDD:239212" misc_feature order(901..903,946..948,991..993,1003..1005,1057..1059, 1072..1074,1078..1080) /locus_tag="NFIA_024180" /note="nucleic acid-binding interface [nucleotide binding]; other site" /db_xref="CDD:239212" misc_feature 1237..>1401 /locus_tag="NFIA_024180" /note="Piwi-like: PIWI domain. Domain found in proteins involved in RNA silencing. RNA silencing refers to a group of related gene-silencing mechanisms mediated by short RNA molecules, including siRNAs, miRNAs, and heterochromatin-related guide RNAs. The...; Region: Piwi-like; cl00628" /db_xref="CDD:294420" ORIGIN
atggaggactacaagcaccagaacaaacttacaggcggccttcgccatcttcatgttgatactactgatgatgttgccaagtacactatttcagttaagacagttactcgcccaaaccacaggcagactggcaaggagatagaagttcttatgaatgcctatcccatcaccaaattccccacctgcaacgtctaccaatacgatgtgcaaatcagaaatggtgttgaaaagaatatcatcattaagaaggtctggaattccaatgctcgcaaggccgccttgaagcagatcatctttgatggtcagaagcttgcctggtctatgaacaactactctaacagtttgaacatggttgtcgatctcaatcaagaacagggtcgccctgctggtagaaccagcaacaccttccatctgactgttcgccggaagactgtcaacctggctgttctcaacgcctggcttactggacgcacctctatgtcagaggcggtccttgaggctatgaacttcctggaccatgtccttcgcgagcatcctagcggcaaattcctggcccttcgtcgctccttcttcgatgagaaaggtgataaccaggatctcggaaacggcgtcttggccttcaagggtgtctaccaggcgatccgtcctgcactgggccgcggtctcattgtcaatgtcgatgtgtccaactcctgcttctgggcgcggacctctttcatgggcgccgccatggtggtgcttgattgtcgggaccatcagcatctgatgcatgttctcaagcctatcagtgacggctatggtggtgttactaagtcaactagcttttataaggtccatcgtcgccttcaaaagctcggggtccagccgcattacagaggctgcccttgcactggtgttgatttcactgtcaagggattgctccatgccaacgctcgacaatatatgatcaagattaaggataaagccactggaaaaaccgagaagatgagtgtggaggcgtactttaagaagaagtacaacctgaccttgaactactgggagcttcctatggttgagatgacgaagaaaggcgttgtctacctaatggaagtgttgacgatccacagactccaccgttacccatggaagttgaatgagtatcagacttcagtaatgatcaagtatgctgcatcacgtcctgcggatcatctcaattccatttataagttaaaggctatactcaaccacgcaaaagaccctgttctcaacactttcggccttgccatcaaagatgatatgattcgcaccaaggcccgtctcttgcctagccccgacattcagtttggtggaaaccagtgcctctctcctggcaccaacggccattgggatctttgtggcaagaaattctatcagccaacaagagaccattag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]