LOCUS       XM_001100305            1528 bp    mRNA    linear   PRI 26-APR-2019
DEFINITION  PREDICTED: Macaca mulatta claudin 17 (CLDN17), mRNA.
ACCESSION   XM_001100305
VERSION     XM_001100305.4
DBLINK      BioProject: PRJNA528504
KEYWORDS    RefSeq.
SOURCE      Macaca mulatta (Rhesus monkey)
  ORGANISM  Macaca mulatta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_041756.1) annotated using gene prediction method: Gnomon,
            supported by mRNA evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Apr 23, 2019 this sequence version replaced XM_001100305.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Macaca mulatta Annotation Release
                                           103
            Annotation Version          :: 103
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.2
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1528
                     /organism="Macaca mulatta"
                     /mol_type="mRNA"
                     /isolate="AG07107"
                     /bio_material="Coriell:AG07107"
                     /db_xref="taxon:9544"
                     /chromosome="3"
                     /sex="female"
                     /tissue_type="fibroblast"
     gene            1..1528
                     /gene="CLDN17"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 mRNAs, 2 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments"
                     /db_xref="GeneID:705582"
     CDS             457..1131
                     /gene="CLDN17"
                     /codon_start=1
                     /product="claudin-17"
                     /protein_id="XP_001100305.1"
                     /db_xref="GeneID:705582"
                     /translation="

MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARARLQCKFYSSLLALPPVLETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANVIIRDFYNPAVHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQRYRYPVPGHCVPHTDKRRNMKMPSNTSTSYV"

     misc_feature    472..1002
                     /gene="CLDN17"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:451326"
ORIGIN      

ttcagctgtgccttaacacatatatttatacttttatatcagagtgattttttacacaggaagtttcagctctgtaattagcaattcacaatggaaactttgacacttaattacagcattgctaagacaataataatgtgagaaatcctaaagctgaatgcagtatttcttgacacacccctagctaccttcttattggctgggaaacaattatatatgactagtaaataatccatagagaaatgaatgtgtatgaaaaaaggcaacatgcatttacaacaggtacttctagttaggccaagttcagtcacagccactgatttggactaaaatgatatgggcagcagccaaggagaacatcatcaaagacttctctagactcaagagccttccacgttctacatcttgagcatcttctaccactccgaattggactagtcttcaaagtaaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacgacgcttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaactgcatccgacaagccagggcccggttgcaatgcaagttctatagttcattgttggctcttccgcctgtcctggaaacagcccgggcactcatgtgtgtggctgttgctctctccttgatcgccctacttattggcatctgtggcatgaagcaagtccagtgcacgggctctaatgagagggccaaagcatatcttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacagccaatgtaatcatcagagatttctacaacccagctgtccacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggaggcggtctgctttgtggattttgctgctgcaacagaaagaagcaaaggtacagatatccagtgcctggccactgtgtgccacacacagataagcgaagaaacatgaaaatgcctagtaatacctccaccagttatgtctaatgcctgcttttggctccaagtgtggactatggtcaatgtttgttataaagtcctgctagaaactgtaagtatgtgaggcaggagaacttgctttatgtctagatttaaattgatatgaaagtttcaatttgttactggtaggaaaacttggacattctgacttcaggtgtattaaatgcatttactattgttggactcaatcgctgttccaatgttcatattctaaatgtaagtatacccataatcattatcaagtgcacaatgatggactactagtttttgaccatcatattttatctgataagaatcaaaatttgaaatcgatattctataacaataaaacatatacctattctaaaatgtaagctattatttttcctctacattgtttcttgta

//