GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 16:02:10, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       XM_001056750            1135 bp    mRNA    linear   ROD 21-JAN-2021
DEFINITION  PREDICTED: Rattus norvegicus claudin 34B (Cldn34b), mRNA.
ACCESSION   XM_001056750
VERSION     XM_001056750.5
DBLINK      BioProject: PRJNA677964
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_051356.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Jan 21, 2021 this sequence version replaced XM_001056750.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Rattus norvegicus Annotation Release
                                           108
            Annotation Version          :: 108
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1135
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN/NHsdMcwi"
                     /db_xref="taxon:10116"
                     /chromosome="X"
                     /sex="male"
                     /tissue_type="kidney"
                     /country="USA: Wisconsin, Milwaukee, Medical College of
                     Wisconsin"
                     /collection_date="2019-03-08"
                     /collected_by="Rebecca Schilling"
     gene            1..1135
                     /gene="Cldn34b"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 3 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:680342"
                     /db_xref="RGD:1592987"
     CDS             260..886
                     /gene="Cldn34b"
                     /codon_start=1
                     /product="claudin-34"
                     /protein_id="XP_001056750.2"
                     /db_xref="GeneID:680342"
                     /db_xref="RGD:1592987"
                     /translation="
MLMKNCHHQMGGFALTTVAWLLCCISIGLPQWQVWHYEDPVILKPTVAFVGIWRTCIFHTDSNSSNNRLCHQYSYRDSFVPLYIRINQHLLLVSSFLGLFGKITTIIALSNVSMGRVRRNATCNPFSLSGILNIIASSFLYLAVLFNYIAIVRKWRVSFPPSFHMPSHPHTQKMGSAMALAIIAAVFFLLSGTICLSSNLGKSPHSKI"
     misc_feature    311..850
                     /gene="Cldn34b"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
ORIGIN      
taggccagtactaataggccaggtgctcataagccaacaaggagactcaaaggataagggagagtcactgtttccttgtcagctccactggcatactttactgattgccctgtcacatcacctaccaacagttaacttgaagacagcaactgtgtattgatgtgatactgtattgcacacagccaatgaaaaggaagtaataaaaaagctgaaaacttccagacttgctgctagttcacaagtattcactgtcaccattatgttgatgaaaaattgccatcaccaaatgggaggttttgctttgaccacagtggcctggctactttgttgcatatccataggcctccctcagtggcaagtgtggcactatgaagaccctgtgatcctcaagcctacagtggcttttgtgggcatatggagaacctgcattttccacactgacagcaactccagcaacaacagattatgtcaccaatacagctaccgtgattccttcgttcctttgtatattcgaataaaccagcacttgctgctggtttctagctttcttgggctctttgggaaaatcaccaccattattgctctttcgaatgtgagtatgggaagagtacggaggaatgccacctgcaatccattcagcctttcagggattctgaacatcattgctagcagctttctttaccttgctgttttgtttaattacatagccatcgtgcgcaaatggagggtttccttcccaccatctttccatatgccttcccacccacacactcagaagatgggaagtgccatggctttggcaattatagctgcagttttctttctactaagtggcacaatttgcctttcttcaaatttaggcaagtcgccccattccaaaatttaaaagtaaattactacctaacatagccttgaaatgccagcaaagatagtgactagtcttccttcatgtgtctatataaattttcaaacatcttgaaaggatgccaattgtggcctgtgacaaagaaagagtccagttgacttccccttatatttttgggcttctttgtgtcatcttaattcattatttggattgtgggattttgttaaataaaaatctcatttaatgggtagtaataaatttgtgttttac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]