GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-19 17:23:42, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       NM_207586               1538 bp    mRNA    linear   ROD 28-APR-2025
DEFINITION  Rattus norvegicus chitinase, acidic (Chia), mRNA.
ACCESSION   NM_207586 XM_227565
VERSION     NM_207586.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1538)
  AUTHORS   Verwer,P.E., ten Kate,M.T., Falcone,F.H., Morroll,S.,
            Verbrugh,H.A., Bakker-Woudenberg,I.A. and van de Sande,W.W.
  TITLE     Evidence supporting a role for mammalian chitinases in efficacy of
            caspofungin against experimental aspergillosis in immunocompromised
            rats
  JOURNAL   PLoS One 8 (10), e75848 (2013)
   PUBMED   24155872
  REMARK    GeneRIF: Invasive pulmonary aspergillosis in immunocompromised rats
            caused a dramatic increase in chitinase activity.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1538)
  AUTHORS   Cho,W.S., Kim,T.H., Lee,H.M., Lee,S.H., Lee,S.H., Yoo,J.H.,
            Kim,Y.S. and Lee,S.H.
  TITLE     Increased expression of acidic mammalian chitinase and
            chitotriosidase in the nasal mucosa of patients with allergic
            rhinitis
  JOURNAL   Laryngoscope 120 (5), 870-875 (2010)
   PUBMED   20422678
REFERENCE   3  (bases 1 to 1538)
  AUTHORS   Wu,A.C., Lasky-Su,J., Rogers,C.A., Klanderman,B.J. and Litonjua,A.
  TITLE     Polymorphisms of chitinases are not associated with asthma
  JOURNAL   J Allergy Clin Immunol 125 (3), 754-757 (2010)
   PUBMED   20226308
REFERENCE   4  (bases 1 to 1538)
  AUTHORS   Yang,C.J., Liu,Y.K., Liu,C.L., Shen,C.N., Kuo,M.L., Su,C.C.,
            Tseng,C.P., Yen,T.C. and Shen,C.R.
  TITLE     Inhibition of acidic mammalian chitinase by RNA interference
            suppresses ovalbumin-sensitized allergic asthma
  JOURNAL   Hum Gene Ther 20 (12), 1597-1606 (2009)
   PUBMED   19548841
REFERENCE   5  (bases 1 to 1538)
  AUTHORS   Seibold,M.A., Reese,T.A., Choudhry,S., Salam,M.T., Beckman,K.,
            Eng,C., Atakilit,A., Meade,K., Lenoir,M., Watson,H.G., Thyne,S.,
            Kumar,R., Weiss,K.B., Grammer,L.C., Avila,P., Schleimer,R.P.,
            Fahy,J.V., Rodriguez-Santana,J., Rodriguez-Cintron,W., Boot,R.G.,
            Sheppard,D., Gilliland,F.D., Locksley,R.M. and Burchard,E.G.
  TITLE     Differential enzymatic activity of common haplotypic versions of
            the human acidic Mammalian chitinase protein
  JOURNAL   J Biol Chem 284 (29), 19650-19658 (2009)
   PUBMED   19435888
REFERENCE   6  (bases 1 to 1538)
  AUTHORS   Ramanathan,M. Jr., Lee,W.K. and Lane,A.P.
  TITLE     Increased expression of acidic mammalian chitinase in chronic
            rhinosinusitis with nasal polyps
  JOURNAL   Am J Rhinol 20 (3), 330-335 (2006)
   PUBMED   16871939
REFERENCE   7  (bases 1 to 1538)
  AUTHORS   Bierbaum,S., Nickel,R., Koch,A., Lau,S., Deichmann,K.A., Wahn,U.,
            Superti-Furga,A. and Heinzmann,A.
  TITLE     Polymorphisms and haplotypes of acid mammalian chitinase are
            associated with bronchial asthma
  JOURNAL   Am J Respir Crit Care Med 172 (12), 1505-1509 (2005)
   PUBMED   16179638
REFERENCE   8  (bases 1 to 1538)
  AUTHORS   Zhu,Z., Zheng,T., Homer,R.J., Kim,Y.K., Chen,N.Y., Cohn,L.,
            Hamid,Q. and Elias,J.A.
  TITLE     Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13
            pathway activation
  JOURNAL   Science 304 (5677), 1678-1682 (2004)
   PUBMED   15192232
REFERENCE   9  (bases 1 to 1538)
  AUTHORS   Zimmermann,N., Mishra,A., King,N.E., Fulkerson,P.C., Doepker,M.P.,
            Nikolaidis,N.M., Kindinger,L.E., Moulton,E.A., Aronow,B.J. and
            Rothenberg,M.E.
  TITLE     Transcript signatures in experimental asthma: identification of
            STAT6-dependent and -independent pathways
  JOURNAL   J Immunol 172 (3), 1815-1824 (2004)
   PUBMED   14734765
REFERENCE   10 (bases 1 to 1538)
  AUTHORS   Boot,R.G., Blommaart,E.F., Swart,E., Ghauharali-van der Vlugt,K.,
            Bijl,N., Moe,C., Place,A. and Aerts,J.M.
  TITLE     Identification of a novel acidic mammalian chitinase distinct from
            chitotriosidase
  JOURNAL   J Biol Chem 276 (9), 6770-6778 (2001)
   PUBMED   11085997
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AY486074.1.
            
            On Aug 30, 2012 this sequence version replaced NM_207586.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY486074.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN12840130, SAMN16676784
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1538              AY486074.1         3-1540
FEATURES             Location/Qualifiers
     source          1..1538
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="2"
                     /map="2q34"
     gene            1..1538
                     /gene="Chia"
                     /note="chitinase, acidic"
                     /db_xref="GeneID:113901"
                     /db_xref="RGD:1303058"
     exon            1..48
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     CDS             24..1445
                     /gene="Chia"
                     /EC_number="3.2.1.14"
                     /note="eosinophil chemotactic cytokine; acidic mammalian
                     chitinase; AMCase; small acid mammalian chitinase"
                     /codon_start=1
                     /product="acidic mammalian chitinase precursor"
                     /protein_id="NP_997469.1"
                     /db_xref="GeneID:113901"
                     /db_xref="RGD:1303058"
                     /translation="
MAKLILVTGLVLLLNVQLGSAYNLVCYFTNWAQYRPGLGSFKPDDINPCLCTHLIYAFAGMQNNQITTIEWNDVTLYKAFNDLKNRNSKLKTLLAIGGWNFGTAPFTTMVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSRGSPPQDKHLFTVLVKELREAFEQEAIESNRPRLMVTAAVAAGISNIQAGYEIPELSQYLDFIHVMTYDLHGSWDGYTGENSPLYKLPTETGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPEYGHTYILSNPSDTGIGAPTSGNGPAGPYTRQAGFWAYYEICTFLRNGATQDWDAPQEVPYAYKGNEWVGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFCDQGKFPLTSTLNKALDIPTAGCTAPDLPSEPVTTPPGSGSGGGSSGGGSEGSGFCAGKADGLYPVADDRNAFWHCINGITYQQHCQAGLVFDTSCNCCNWP"
     sig_peptide     24..86
                     /gene="Chia"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     mat_peptide     87..1442
                     /gene="Chia"
                     /product="Acidic mammalian chitinase. /id=PRO_0000011946"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6RY07.1)"
     misc_feature    93..1184
                     /gene="Chia"
                     /note="This conserved domain family includes a large
                     number of catalytically inactive chitinase-like lectins
                     (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1,
                     oviductin, and AMCase (acidic mammalian chitinase), as
                     well as catalytically active...; Region:
                     GH18_chitolectin_chitotriosidase; cd02872"
                     /db_xref="CDD:119351"
     misc_feature    order(102..104,114..116,318..323,435..437,441..446,
                     579..584,651..653,657..662,675..677,822..824,828..830,
                     912..914,1101..1103)
                     /gene="Chia"
                     /note="active site"
                     /db_xref="CDD:119351"
     misc_feature    1206..1286
                     /gene="Chia"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6RY07.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    1299..1442
                     /gene="Chia"
                     /note="Chitin-binding domain type 2; Region: ChtBD2;
                     smart00494"
                     /db_xref="CDD:214696"
     exon            49..78
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            79..280
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            281..337
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            338..503
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            504..628
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            629..752
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            753..938
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            939..1058
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            1059..1200
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
     exon            1201..1538
                     /gene="Chia"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcgggggcagtactgaagacaacatggccaagctcattcttgtcacaggtctggttcttctgctgaatgttcagctggggtctgcctacaatctggtatgctacttcaccaactgggcccagtatcggccaggcctggggagtttcaagcctgatgacattaatccctgcctgtgtactcacctgatctatgcctttgctgggatgcagaacaatcaaatcaccaccatagaatggaatgatgttactctctataaagctttcaatgacttgaaaaacaggaacagcaaactgaaaactctcctggcaattggaggttggaactttggaactgctcctttcaccaccatggtttccacttctcagaaccgccagacctttattacctcagtcatcaaattcctgcgacagtatgggtttgatggactggacctggactgggaatacccaggttcacgtgggagccctcctcaggacaagcatctcttcactgtcctggtgaaggaactacgtgaagcttttgagcaggaggctattgagagcaacaggcccagattgatggttactgctgctgtagctgctggcatttccaacatccaggctggctacgagatccctgaactttctcagtacctggatttcatccacgtcatgacatatgacctccatggctcctgggatggctacactggggagaacagtcctctttacaaactccctactgagactggcagcaatgcctacctcaatgtggattatgtcatgaattactggaaggataatggagccccagctgagaagctcattgttggatttccagagtatggacacacctacatcctaagcaacccttctgatactggaattggtgcccctacctctggtaatggccctgctgggccctataccaggcaggctgggttctgggcctactatgagatttgtacctttctgagaaatggagccactcaggactgggatgccccccaggaagttccctatgcctacaagggcaatgagtgggttggctatgataatatcaagagcttcagtgtcaaggctcagtggcttaagcagaacaactttggtggtgccatgatctgggccattgaccttgatgacttcactggctctttctgtgaccagggaaaattccctctgacttctactttgaataaagcccttgatatacccacagcaggttgcacagcccctgacttaccttctgaaccagtaactactcctccaggaagtgggagtggtggtggaagctctggtggaggttctgaaggcagtggattctgtgctggcaaagcagatggcctctaccctgtggcagatgacagaaatgctttctggcactgcatcaatggaatcacatatcagcagcattgtcaggcagggttagtttttgataccagctgtaattgctgcaactggccatgaaactaatgttcttcacgaaatttctgccttctcccttaatcctcaccaaaggtagcttgcttccatttaaagttatgcaataaaattgatagc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]