GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:33:28, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_205252               1845 bp    mRNA    linear   VRT 26-DEC-2019
DEFINITION  Gallus gallus hematopoietically expressed homeobox (HHEX), mRNA.
ACCESSION   NM_205252
VERSION     NM_205252.1
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1845)
  AUTHORS   Obinata A and Akimoto Y.
  TITLE     Involvement of Hex in the initiation of feather morphogenesis
  JOURNAL   Int. J. Dev. Biol. 49 (8), 953-960 (2005)
   PUBMED   16281172
  REMARK    GeneRIF: Hex is upstream of Wnt7a and beta-catenin and regulates
            the Wnt signaling pathway in feather bud initiation
REFERENCE   2  (bases 1 to 1845)
  AUTHORS   Obinata A and Akimoto Y.
  TITLE     Expression of Hex during feather bud development
  JOURNAL   Int. J. Dev. Biol. 49 (7), 885-890 (2005)
   PUBMED   16172986
  REMARK    GeneRIF: Hex plays an important role in the initiation of feather
            morphogenesis
REFERENCE   3  (bases 1 to 1845)
  AUTHORS   Crompton MR, Bartlett TJ, MacGregor AD, Manfioletti G, Buratti E,
            Giancotti V and Goodwin GH.
  TITLE     Identification of a novel vertebrate homeobox gene expressed in
            haematopoietic cells
  JOURNAL   Nucleic Acids Res. 20 (21), 5661-5667 (1992)
   PUBMED   1360645
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from X64711.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X64711.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1845
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="6"
                     /map="6"
     gene            1..1845
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="hematopoietically expressed homeobox"
                     /db_xref="CGNC:66222"
                     /db_xref="GeneID:396182"
     exon            1..468
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /inference="alignment:Splign:2.1.0"
     CDS             87..920
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="homeobox protein HEX; homeobox protein PRH"
                     /codon_start=1
                     /product="hematopoietically-expressed homeobox protein
                     HHEX"
                     /protein_id="NP_990583.1"
                     /db_xref="CGNC:66222"
                     /db_xref="GeneID:396182"
                     /translation="
MQYQAPGAAPAAALGVGVPLYAPTPLLQPAHPTPFYIEDILGRGPAAAPAPHSLPAPPPPTLPSPNSSFTSLVAPYRTPVYEPTPIHPAFSHHLAATYGTGAYAGPLYSFPRAVGDYTHALIRQDPLGKPLLWSPFIQRPLHKRKGGQVRFSNEQTIELEKKFETQKYLSPPERKRLAKLLQLSERQVKTWFQNRRAKWRRLKQENPQATKKEEAEGTGDHGDPRSEGSPSPAGGGEAEPQDSPSAASQEDPESDVSDDSDQEVDIEGDKGFYSATR"
     misc_feature    order(519..533,537..539,588..590,606..608,645..647,
                     651..656,663..668,672..680,684..689)
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(525..527,534..536,654..656,663..668,675..677)
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    534..686
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     exon            469..647
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /inference="alignment:Splign:2.1.0"
     exon            648..698
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /inference="alignment:Splign:2.1.0"
     exon            699..1845
                     /gene="HHEX"
                     /gene_synonym="PROBOX"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcggcggcggtggcagcagccggcggccgcgctcggggccgctctccgaggggcggccgggccgcggggggccggggagccgcgccatgcagtatcaggcgccgggcgcggctccggcggcggccctgggcgtcggcgtccctctgtacgcgcccacgccgctgctgcagcccgcgcaccccacgcccttctacatcgaggacatcctgggccgcggccccgccgccgcgccggccccccactccctgcccgccccgccgccgccgacgctgccgtcgcccaactcctccttcaccagcctggtggccccgtaccggacccccgtctacgagccgacccccatccacccggccttctctcaccacctcgccgccacctacggcaccggcgcttacgccgggcccctctactcctttccccgcgccgtcggcgactacacgcacgcactgatccgccaggaccccctgggaaagccgctgctgtggagccccttcatccagcggccgctgcataagaggaagggtgggcaggtgcgcttctccaacgagcagaccatcgagctggagaagaagttcgagacgcagaaatacctctccccgcccgagaggaagcgcctggccaagctgctgcagctcagcgagcgccaggtcaaaacgtggttccagaaccgcagagccaaatggaggcgactgaagcaggagaacccccaggccaccaaaaaggaggaggcggaaggcaccggcgatcacggcgaccctcggtcggagggcagccccagccccgcgggggggggcgaggccgagccgcaggacagcccttcggccgcctcgcaggaggaccccgagtccgacgtctccgacgactccgaccaggaggtggacatcgagggcgacaaaggcttctacagcgccacacgctgacggcccgcgggcacggagccgagctcggcttgcgctgtcccgggactgcgggaaggaggattttatgacgggagaggaccttcaccattccgccgaaagacaaagaagcacgaacggactcgttctgtaataatctgagaaagaaaagatattcgttctgcaaacggtccgtttttttttggcagatctctgatttgattgtagggactgatcggtggtttgtatttactgtgtaagatctgtgtgtatgttgattggtgctctgaccgggacacagcgctgtgcccatctccggctgctggaacccccctcttccccagctcgtgtagtgggggagcactgagggcaccaccgtgcctttgtgtgtgcgaacgaatctgctttaaatggagtaatttaagtgtccttcgcaggcagagaaatgtattctgtgccatagagagggattggagcatcccgagagtgccttaccccacccaggacctgcagctgcatcccccggaaggatcccccctcaccgggcagaggctgtgggcacgttccgttttgctcttgatggagtgaaatgtccctcatcgcattttggaggattttgccccacaatctgtgtggttccatttgcagggaaaaaaaaaaacaaaacaaaaacaaaaaccaaacacagcaacaaaccaacccaggctatttttttccttgacaaatctgtcgtgctgtcccccagatttcccatttcagaaggaaatgaggggctgatagggcactgcgaggcgcagtgtgacagcgggcacccgtgcctggcgtgtccctctctgctcgtgtacatagcagtttgccttaaaagtctttgcggttttatacctcacattgttcatattttgtacatattggtttaaaagaaaaaaaaaaaaaggaatcaaaaactggt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]