GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-17 07:35:07, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_181550                892 bp    mRNA    linear   ROD 30-APR-2025
DEFINITION  Rattus norvegicus sequestosome 1 (Sqstm1), transcript variant 2,
            mRNA.
ACCESSION   NM_181550
VERSION     NM_181550.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 892)
  AUTHORS   Jiang,G., Shi,L.F., Li,L.J., Duan,X.J. and Zheng,Z.F.
  TITLE     Activation of the p62-Keap1-Nrf2 pathway improves pulmonary
            arterial hypertension in MCT-induced rats by inhibiting autophagy
  JOURNAL   FASEB J 38 (3), e23452 (2024)
   PUBMED   38308640
  REMARK    GeneRIF: Activation of the p62-Keap1-Nrf2 pathway improves
            pulmonary arterial hypertension in MCT-induced rats by inhibiting
            autophagy.
REFERENCE   2  (bases 1 to 892)
  AUTHORS   Chernyshova,E.V., Gureev,A.P., Sadovnikova,I.S., Plotnikov,E.Y.,
            Silachev,D.N., Zorov,D.B. and Popov,V.N.
  TITLE     The Relationship of p62 Gene Expression with Integrity of
            Mitochondrial DNA and the Level of Lipid Peroxidation Products in
            Skeletal Muscles of Rats of Different Ages Exposed to Different
            Feeding Protocols
  JOURNAL   Bull Exp Biol Med 175 (2), 245-248 (2023)
   PUBMED   37466855
  REMARK    GeneRIF: The Relationship of p62 Gene Expression with Integrity of
            Mitochondrial DNA and the Level of Lipid Peroxidation Products in
            Skeletal Muscles of Rats of Different Ages Exposed to Different
            Feeding Protocols.
REFERENCE   3  (bases 1 to 892)
  AUTHORS   Zhang,X.X., Lang,Y.F., Li,X., Li,Z., Xu,Y.Q. and Chu,H.Q.
  TITLE     The protective effect of puerarin-loaded mesoporous silicon
            nanoparticles on alcoholic hepatitis through mTOR-mediated
            autophagy pathway
  JOURNAL   Biomed Microdevices 24 (4), 37 (2022)
   PUBMED   36308627
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 892)
  AUTHORS   Zeng,T., Zhang,S., He,Y., Liu,Z. and Cheng,Q.
  TITLE     MiR-361-5p promotes oxygen-glucose deprivation/re-oxygenation
            induced neuronal injury by negatively regulating SQSTM1 in vitro
  JOURNAL   Metab Brain Dis 36 (8), 2359-2368 (2021)
   PUBMED   34581931
  REMARK    GeneRIF: MiR-361-5p promotes oxygen-glucose
            deprivation/re-oxygenation induced neuronal injury by negatively
            regulating SQSTM1 in vitro.
REFERENCE   5  (bases 1 to 892)
  AUTHORS   Babuta,M., Furi,I., Bala,S., Bukong,T.N., Lowe,P., Catalano,D.,
            Calenda,C., Kodys,K. and Szabo,G.
  TITLE     Dysregulated Autophagy and Lysosome Function Are Linked to Exosome
            Production by Micro-RNA 155 in Alcoholic Liver Disease
  JOURNAL   Hepatology 70 (6), 2123-2141 (2019)
   PUBMED   31090940
REFERENCE   6  (bases 1 to 892)
  AUTHORS   Wooten,M.W., Seibenhener,M.L., Mamidipudi,V., Diaz-Meco,M.T.,
            Barker,P.A. and Moscat,J.
  TITLE     The atypical protein kinase C-interacting protein p62 is a scaffold
            for NF-kappaB activation by nerve growth factor
  JOURNAL   J Biol Chem 276 (11), 7709-7712 (2001)
   PUBMED   11244088
REFERENCE   7  (bases 1 to 892)
  AUTHORS   Kuusisto,E., Suuronen,T. and Salminen,A.
  TITLE     Ubiquitin-binding protein p62 expression is induced during
            apoptosis and proteasomal inhibition in neuronal cells
  JOURNAL   Biochem Biophys Res Commun 280 (1), 223-228 (2001)
   PUBMED   11162503
REFERENCE   8  (bases 1 to 892)
  AUTHORS   Gong,J., Xu,J., Bezanilla,M., van Huizen,R., Derin,R. and Li,M.
  TITLE     Differential stimulation of PKC phosphorylation of potassium
            channels by ZIP1 and ZIP2
  JOURNAL   Science 285 (5433), 1565-1569 (1999)
   PUBMED   10477520
REFERENCE   9  (bases 1 to 892)
  AUTHORS   Nakaso,K., Kitayama,M., Ishii,T., Bannai,S., Yanagawa,T.,
            Kimura,K., Nakashima,K., Ohama,E. and Yamada,K.
  TITLE     Effects of kainate-mediated excitotoxicity on the expression of rat
            counterparts of A170 and MSP23 stress proteins in the brain
  JOURNAL   Brain Res Mol Brain Res 69 (2), 155-163 (1999)
   PUBMED   10366737
REFERENCE   10 (bases 1 to 892)
  AUTHORS   Joung,I., Strominger,J.L. and Shin,J.
  TITLE     Molecular cloning of a phosphotyrosine-independent ligand of the
            p56lck SH2 domain
  JOURNAL   Proc Natl Acad Sci U S A 93 (12), 5991-5995 (1996)
   PUBMED   8650207
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000010.1.
            
            On Mar 19, 2021 this sequence version replaced NM_181550.1.
            
            Transcript Variant: This variant (2) lacks several exons and its
            transcription extends past a splice site that is used in variant 1.
            This results in a novel 3' coding region and 3' UTR, compared to
            variant 1. It encodes isoform 2 which is shorter and has a distinct
            C-terminus, compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF439403.1, SRR26360172.838859.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN12840115, SAMN12840116
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-233               JAXUCZ010000010.1  35037518-35037750   c
            234-329             JAXUCZ010000010.1  35035464-35035559   c
            330-556             JAXUCZ010000010.1  35034996-35035222   c
            557-892             JAXUCZ010000010.1  35034558-35034893   c
FEATURES             Location/Qualifiers
     source          1..892
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q22"
     gene            1..892
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="sequestosome 1"
                     /db_xref="GeneID:113894"
                     /db_xref="RGD:69287"
     exon            1..233
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    23..25
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="upstream in-frame stop codon"
     CDS             35..739
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="isoform 2 is encoded by transcript variant 2;
                     oxidative stress induced; protein kinase
                     C-zeta-interacting protein; ubiquitin-binding protein p62;
                     PKC-zeta-interacting protein"
                     /codon_start=1
                     /product="sequestosome-1 isoform 2"
                     /protein_id="NP_853528.2"
                     /db_xref="GeneID:113894"
                     /db_xref="RGD:69287"
                     /translation="
MASLTVKAYLLGKEEAAREIRRFSFCFSPEPEAEAAAGPGPCERLLSRVAVLFPALRPGGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRREHRPPCAQEARSMVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHREHSKLIFPNPFGHLSDSFSHSRWLRKLKHGHFGWPGWEMGPPGNWSPRPPRAGDGRPCPTAESGKAGVCTGFRCHK"
     misc_feature    38..178
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="propagated from UniProtKB/Swiss-Prot (O08623.1);
                     Region: Interaction with LCK.
                     /evidence=ECO:0000250|UniProtKB:Q13501"
     misc_feature    38..40
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="N-acetylalanine.
                     /evidence=ECO:0000250|UniProtKB:Q13501; propagated from
                     UniProtKB/Swiss-Prot (O08623.1); acetylation site"
     misc_feature    44..334
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="The PB1 domain is an essential part of p62 scaffold
                     protein (alias sequestosome 1,SQSTM) involved in cell
                     signaling, receptor internalization, and protein turnover.
                     The PB1 domain is a modular domain mediating specific
                     protein-protein interaction which...; Region: PB1_p62;
                     cd06402"
                     /db_xref="CDD:99723"
     misc_feature    104..106
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q13501; propagated from
                     UniProtKB/Swiss-Prot (O08623.1); phosphorylation site"
     misc_feature    155..349
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="propagated from UniProtKB/Swiss-Prot (O08623.1);
                     Region: Interaction with PRKCZ and dimerization.
                     /evidence=ECO:0000269|PubMed:10477520,
                     ECO:0000269|PubMed:12431995"
     misc_feature    176..268
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="propagated from UniProtKB/Swiss-Prot (O08623.1);
                     Region: Interaction with PAWR.
                     /evidence=ECO:0000250|UniProtKB:Q13501"
     misc_feature    389..697
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="propagated from UniProtKB/Swiss-Prot (O08623.1);
                     Region: Interaction with GABRR3.
                     /evidence=ECO:0000269|PubMed:12431995"
     misc_feature    401..523
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="Zinc finger, ZZ type. Zinc finger present in
                     Drosophila ref(2)P, NBR1, Human sequestosome 1 and related
                     proteins. The ZZ motif coordinates two zinc ions and most
                     likely participates in ligand binding or molecular
                     scaffolding. Drosophila ref(2)P appears...; Region:
                     ZZ_NBR1_like; cd02340"
                     /db_xref="CDD:239080"
     misc_feature    order(407..409,416..418,449..451,458..460,476..478,
                     485..487,503..505,512..514)
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="Zinc-binding sites [ion binding]; other site"
                     /db_xref="CDD:239080"
     misc_feature    order(407..409,416..418,476..478,485..487)
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="zinc cluster 1 [ion binding]; other site"
                     /db_xref="CDD:239080"
     misc_feature    order(410..412,440..442,446..448,464..466,470..472)
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="putative charged binding surface [active]"
                     /db_xref="CDD:239080"
     misc_feature    order(449..451,458..460,503..505,512..514)
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="zinc cluster 2 [ion binding]; other site"
                     /db_xref="CDD:239080"
     misc_feature    467..469
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="Phosphotyrosine.
                     /evidence=ECO:0000250|UniProtKB:Q13501; propagated from
                     UniProtKB/Swiss-Prot (O08623.1); phosphorylation site"
     misc_feature    533..685
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="propagated from UniProtKB/Swiss-Prot (O08623.1);
                     Region: LIM protein-binding.
                     /evidence=ECO:0000250|UniProtKB:Q13501"
     misc_feature    551..553
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q13501; propagated from
                     UniProtKB/Swiss-Prot (O08623.1); phosphorylation site"
     misc_feature    557..559
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q64337; propagated from
                     UniProtKB/Swiss-Prot (O08623.1); phosphorylation site"
     misc_feature    644..646
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /note="Phosphoserine.
                     /evidence=ECO:0000250|UniProtKB:Q13501; propagated from
                     UniProtKB/Swiss-Prot (O08623.1); phosphorylation site"
     exon            234..329
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /inference="alignment:Splign:2.1.0"
     exon            330..556
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /inference="alignment:Splign:2.1.0"
     exon            557..892
                     /gene="Sqstm1"
                     /gene_synonym="Osi; ZIP; ZIP3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcccagctgtttcctccgtacctagtctgcggttatggcttcgctcacggtgaaggcctatctactgggcaaggaggaggcggcccgcgagatccgccgcttcagcttctgcttcagcccggagccggaggcggaagccgcggctggcccggggccctgcgagaggctgctgagccgggtggctgtgctgttccccgcgctgcggcctggaggctttcaggcgcactaccgcgatgaggatggggacttggtcgccttctccagtgatgaggaactgacaatggccatgtcctatgtgaaagatgacatcttccgcatctacattaaagagaagaaggagtgccggcgggaacatcgccccccatgtgctcaggaggcacgaagcatggtgcaccccaacgtgatttgtgatggttgcaatgggcctgtggtgggaactcgctataagtgcagtgtgtgccccgactacgacctgtgcagcgtctgcgaggggaagggcctgcacagggagcacagcaagctcatctttcccaacccctttggccacctctctgatagcttctctcatagccgctggcttcggaagctgaaacatgggcactttggctggcctggctgggagatgggcccaccagggaactggagcccacgtcctcctcgcgcaggggatggtcgcccttgccccacagctgagtcgggtaaggctggtgtttgcactggctttaggtgtcataagtagccagcttgttcaggtggacccttggcctaaagtccagaagttcctacaatcagctgtacattacacatccgtttaatttttttggtctttgggggtatggaggttgaacctagggccttgcacataataaataagggctcctttgttgtgcta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]