GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-07 23:21:05, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_172337               2911 bp    mRNA    linear   PRI 21-JAN-2020
DEFINITION  Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 2,
            mRNA.
ACCESSION   NM_172337
VERSION     NM_172337.3
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2911)
  AUTHORS   Figueira Muoio VM, Uno M, Oba-Shinjo S, da Silva R, Araujo Pereira
            BJ, Clara C, Matushita H and Marie SNK.
  TITLE     OTX1 and OTX2 Genes in Medulloblastoma
  JOURNAL   World Neurosurg 127, e58-e64 (2019)
   PUBMED   30797919
  REMARK    GeneRIF: The OTX2 gene was expressed in 62% of 60 Brazilian
            medulloblastoma patients. Expression varied with age (higher in
            younger age groups), location (predominantly vermis), and
            histological type (classic and anaplastic). A statistical
            correlation between OTX2 gene expression and the development of
            leptomeningeal metastases was observed.
            Erratum:[World Neurosurg. 2019 Oct;130:377. PMID: 31421436]
REFERENCE   2  (bases 1 to 2911)
  AUTHORS   Sakai A and Sugiyama S.
  TITLE     Experience-dependent transcriptional regulation in juvenile brain
            development
  JOURNAL   Dev. Growth Differ. 60 (8), 473-482 (2018)
   PUBMED   30368782
  REMARK    GeneRIF: It identified downstream targets of Otx2 suggest novel
            roles of Otx2 in homeostasis of PV cells, and, moreover, in
            regulation of chromatin state, which is important for neuronal
            plasticity.
            Review article
REFERENCE   3  (bases 1 to 2911)
  AUTHORS   Kaufman J, Wymbs NF, Montalvo-Ortiz JL, Orr C, Albaugh MD, Althoff
            R, O'Loughlin K, Holbrook H, Garavan H, Kearney C, Yang BZ, Zhao H,
            Pena C, Nestler EJ, Lee RS, Mostofsky S, Gelernter J and Hudziak J.
  TITLE     Methylation in OTX2 and related genes, maltreatment, and depression
            in children
  JOURNAL   Neuropsychopharmacology 43 (11), 2204-2211 (2018)
   PUBMED   30089883
  REMARK    GeneRIF: Maltreatment history and DNA methylation in OTX2
            significantly predicted depression in children.
REFERENCE   4  (bases 1 to 2911)
  AUTHORS   Su Z, Zhang Y, Liao B, Zhong X, Chen X, Wang H, Guo Y, Shan Y, Wang
            L and Pan G.
  TITLE     Antagonism between the transcription factors NANOG and OTX2
            specifies rostral or caudal cell fate during neural patterning
            transition
  JOURNAL   J. Biol. Chem. 293 (12), 4445-4455 (2018)
   PUBMED   29386354
  REMARK    GeneRIF: have uncovered a mutual antagonism between NANOG and OTX2
            underlying cell fate decisions during neural patterning, critical
            for the regulation of early neural development in humans
REFERENCE   5  (bases 1 to 2911)
  AUTHORS   Fong SL and Fong WB.
  TITLE     Elements regulating the transcription of human interstitial
            retinoid-binding protein (IRBP) gene in cultured retinoblastoma
            cells
  JOURNAL   Curr. Eye Res. 18 (4), 283-291 (1999)
   PUBMED   10372988
REFERENCE   6  (bases 1 to 2911)
  AUTHORS   Bobola N, Briata P, Ilengo C, Rosatto N, Craft C, Corte G and
            Ravazzolo R.
  TITLE     OTX2 homeodomain protein binds a DNA element necessary for
            interphotoreceptor retinoid binding protein gene expression
  JOURNAL   Mech. Dev. 82 (1-2), 165-169 (1999)
   PUBMED   10354480
REFERENCE   7  (bases 1 to 2911)
  AUTHORS   Nagao T, Leuzinger S, Acampora D, Simeone A, Finkelstein R,
            Reichert H and Furukubo-Tokunaga K.
  TITLE     Developmental rescue of Drosophila cephalic defects by the human
            Otx genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 95 (7), 3737-3742 (1998)
   PUBMED   9520436
REFERENCE   8  (bases 1 to 2911)
  AUTHORS   Kastury K, Druck T, Huebner K, Barletta C, Acampora D, Simeone A,
            Faiella A and Boncinelli E.
  TITLE     Chromosome locations of human EMX and OTX genes
  JOURNAL   Genomics 22 (1), 41-45 (1994)
   PUBMED   7959790
REFERENCE   9  (bases 1 to 2911)
  AUTHORS   Kumaran,N., Pennesi,M.E., Yang,P., Trzupek,K.M., Schlechter,C.,
            Moore,A.T., Weleber,R.G. and Michaelides,M.
  TITLE     Leber Congenital Amaurosis / Early-Onset Severe Retinal Dystrophy
            Overview
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   30285347
REFERENCE   10 (bases 1 to 2911)
  AUTHORS   Bardakjian,T., Weiss,A. and Schneider,A.
  TITLE     Microphthalmia/Anophthalmia/Coloboma Spectrum
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   20301552
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL161757.4, AB593056.1,
            AB593057.1 and BC032579.1.
            On Jun 2, 2019 this sequence version replaced NM_172337.2.
            
            Summary: This gene encodes a member of the bicoid subfamily of
            homeodomain-containing transcription factors. The encoded protein
            acts as a transcription factor and plays a role in brain,
            craniofacial, and sensory organ development. The encoded protein
            also influences the proliferation and differentiation of
            dopaminergic neuronal progenitor cells during mitosis. Mutations in
            this gene cause syndromic microphthalmia 5 (MCOPS5) and combined
            pituitary hormone deficiency 6 (CPHD6). This gene is also suspected
            of having an oncogenic role in medulloblastoma. Alternative
            splicing results in multiple transcript variants encoding distinct
            isoforms. Pseudogenes of this gene are known to exist on
            chromosomes two and nine. [provided by RefSeq, Jul 2012].
            
            Transcript Variant: This variant (2) differs in the 5' UTR and
            lacks an in-frame segment of the coding region, compared to variant
            1, and, compared to isoform a, encodes a shorter isoform (b).
            Variants 2-4 encode the same protein (isoform b).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB593057.1, SRR1803613.184072.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2148093, SAMN03465402
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-4                 AL161757.4         59910-59913
            5-234               AB593056.1         4-233
            235-2107            AB593057.1         1-1873
            2108-2109           BC032579.1         2206-2207
            2110-2911           AL161757.4         64871-65672
FEATURES             Location/Qualifiers
     source          1..2911
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q22.3"
     gene            1..2911
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="orthodenticle homeobox 2"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
     exon            1..308
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       15
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1028025946"
     variation       19
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:995663284"
     variation       21
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1187828004"
     variation       25
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966424967"
     variation       26
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566625629"
     variation       28
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886050561"
     variation       32
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1170533264"
     variation       34
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1401837548"
     variation       42
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016145843"
     variation       44
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:992379797"
     variation       50
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:959615923"
     variation       51
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1386513381"
     misc_feature    53..55
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="upstream in-frame stop codon"
     variation       57
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266672856"
     variation       61
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1441681039"
     variation       63
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1241496038"
     variation       67..80
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tgtttgtttg"
                     /replace="tgtttgtttgtttg"
                     /db_xref="dbSNP:886050560"
     variation       74
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1033848381"
     variation       81
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:995710328"
     variation       86
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1208936281"
     variation       111
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:867047559"
     variation       115
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463179835"
     variation       116
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267978893"
     variation       120
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:566671671"
     variation       130
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:540831263"
     variation       146
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196562062"
     variation       147
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056716757"
     variation       148
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1015703211"
     variation       153
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1473067950"
     variation       154
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161674671"
     variation       161
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:546858272"
     variation       162
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747816534"
     variation       165
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776104541"
     variation       166
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200002729"
     variation       167
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326480147"
     variation       168
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373972732"
     variation       169
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564618315"
     variation       170..174
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1566625502"
     variation       170
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312165040"
     variation       171
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779606022"
     variation       174
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758339288"
     variation       175
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1173169407"
     variation       177
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:905188703"
     variation       179
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:546311189"
     variation       183
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370535121"
     variation       185
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757069643"
     variation       191
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754146678"
     variation       192
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209340201"
     variation       194
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486905888"
     variation       195
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764157150"
     variation       202
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1230570861"
     variation       203
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756345000"
     variation       204
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1349359874"
     variation       205
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752785578"
     variation       206
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051054473"
     CDS             212..1081
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="isoform b is encoded by transcript variant 2;
                     homeobox protein OTX2; orthodenticle homolog 2"
                     /codon_start=1
                     /product="homeobox protein OTX2 isoform b"
                     /protein_id="NP_758840.1"
                     /db_xref="CCDS:CCDS41960.1"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
                     /translation="
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL"
     misc_feature    order(326..340,344..346,395..397,413..415,452..454,
                     458..463,470..475,479..487,491..493)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(332..334,341..343,461..463,470..475,482..484)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    335..493
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:333795"
     misc_feature    668..913
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Otx1 transcription factor; Region: TF_Otx;
                     pfam03529"
                     /db_xref="CDD:308893"
     variation       213
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350877109"
     variation       215
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767603643"
     variation       216
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412709573"
     variation       220
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:575736431"
     variation       226
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752010967"
     variation       234
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1400172157"
     variation       235
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382934738"
     variation       236
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766756721"
     variation       241
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997349229"
     variation       242
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763234678"
     variation       244
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1186172721"
     variation       249
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776356711"
     variation       250
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768254721"
     variation       253
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760374061"
     variation       256
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946757953"
     variation       265
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1445883508"
     variation       268
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774907916"
     variation       269
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771687556"
     variation       272
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1207963480"
     variation       273
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745822138"
     variation       274
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:779418668"
     variation       275
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200680654"
     variation       277
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778956556"
     variation       280
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770855748"
     variation       287
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749151724"
     variation       289..292
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:786205874"
     variation       290
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259224286"
     variation       295
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1284677631"
     variation       296
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777618282"
     variation       300
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756331034"
     variation       306
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752941534"
     exon            309..460
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       309
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1449513107"
     variation       312..317
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:758119168"
     variation       312
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:758946986"
     variation       313
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750923926"
     variation       314
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374042850"
     variation       317
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1440715201"
     variation       328
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566624596"
     variation       330
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1555350405"
     variation       337
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246931412"
     variation       342
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203506236"
     variation       343
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435887362"
     variation       349
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757602259"
     variation       354
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229104622"
     variation       355
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354433789"
     variation       358
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347231732"
     variation       360..386
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="tagatgtgctggaagcactgtttgcca"
                     /db_xref="dbSNP:886044145"
     variation       363
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:567955379"
     variation       374
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368759331"
     variation       378..380
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="tgt"
                     /db_xref="dbSNP:1555350397"
     variation       378
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1368488675"
     variation       379
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141664597"
     variation       390
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759256101"
     variation       391
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774043425"
     variation       394
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765964221"
     variation       398
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1064795810"
     variation       400
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762821214"
     variation       403
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867835552"
     variation       405
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1374187856"
     variation       413
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773157352"
     variation       422
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1434432414"
     variation       430..447
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ga"
                     /replace="gaaaatcaacttgcccga"
                     /db_xref="dbSNP:1566624472"
     variation       433
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1390373654"
     variation       445
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769477143"
     variation       446
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:786205224"
     variation       451
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376651816"
     variation       457
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747916036"
     exon            461..2911
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       461
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397190102"
     variation       476
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:104894464"
     variation       477
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200990681"
     variation       481
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1566623392"
     variation       483
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350254"
     variation       492
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:990697953"
     variation       494..513
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="caacaacagca"
                     /replace="caacaacagcaacaacagca"
                     /db_xref="dbSNP:1432265442"
     variation       494
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78953717"
     variation       496
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749788509"
     variation       503
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:786205884"
     variation       514
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867373003"
     variation       515
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566623353"
     variation       517
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778304481"
     variation       523
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536495343"
     variation       528
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751258203"
     variation       537
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779696471"
     variation       538
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757971368"
     variation       539
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750013761"
     variation       540
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1421844456"
     variation       544
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958176763"
     variation       549
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764625033"
     variation       553
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761862286"
     variation       558
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753729345"
     variation       559
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763911822"
     variation       560
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760396081"
     variation       563
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:925178840"
     variation       564
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267666192"
     variation       566
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775702810"
     variation       567
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199799627"
     variation       569
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867148217"
     variation       572
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1294096975"
     variation       573
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774537529"
     variation       575
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748205899"
     variation       579
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:970116042"
     variation       583
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749843466"
     variation       588
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778357805"
     variation       593
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770291855"
     variation       598
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772021946"
     variation       599
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74658806"
     variation       600
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867304376"
     variation       605
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758106958"
     variation       608..613
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1555350223"
     variation       608
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376333965"
     variation       610
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372008404"
     variation       611
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753783256"
     variation       612
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199761861"
     variation       613..616
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ctct"
                     /replace="ctctct"
                     /db_xref="dbSNP:1566623121"
     variation       613
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:553884027"
     variation       624
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:786205879"
     variation       628
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1018175216"
     variation       630
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201721391"
     variation       631
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147896150"
     variation       633
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771047348"
     variation       634
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763064579"
     variation       638
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770486100"
     variation       639
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748631596"
     variation       640
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777104497"
     variation       642
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768857621"
     variation       643
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325619239"
     variation       645
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040844433"
     variation       646
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34537598"
     variation       651
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200171280"
     variation       653
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306099663"
     variation       664
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373798705"
     variation       669
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345597863"
     variation       670
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538192166"
     variation       674..675
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gc"
                     /replace="gcgc"
                     /db_xref="dbSNP:786205873"
     variation       674
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173013598"
     variation       681
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:756087368"
     variation       691
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752526255"
     variation       701
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370354056"
     variation       706
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868464317"
     variation       708
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1224751397"
     variation       712
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767374937"
     variation       721
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886043793"
     variation       727
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368033398"
     variation       730
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184804231"
     variation       732
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566622915"
     variation       737
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751820068"
     variation       739
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766762080"
     variation       740
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1209472542"
     variation       743
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344213875"
     variation       748
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:104894465"
     variation       754
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1257366193"
     variation       761
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773463323"
     variation       763
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334931058"
     variation       765
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286159089"
     variation       767
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765382721"
     variation       768
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762435469"
     variation       771
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776964451"
     variation       773
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:397514463"
     variation       774
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142205965"
     variation       778
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747279627"
     variation       779
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1173365017"
     variation       784
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775913832"
     variation       788
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748910557"
     variation       789
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755578825"
     variation       801
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473138354"
     variation       802
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1216205714"
     variation       803
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:907201088"
     variation       811
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196833377"
     variation       820
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1257411968"
     variation       828
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150982073"
     variation       830
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780929725"
     variation       833
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470784217"
     variation       842
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754929157"
     variation       843
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751376563"
     variation       845..846
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ct"
                     /replace="g"
                     /db_xref="dbSNP:1566622642"
     variation       848
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548455339"
     variation       850
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142743327"
     variation       851
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374968145"
     variation       852
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213822105"
     variation       854
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419408753"
     variation       855
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916022550"
     variation       857..860
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1566622571"
     variation       860
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750626422"
     variation       861
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928898444"
     variation       864
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765441049"
     variation       866
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868121860"
     variation       867
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761733794"
     variation       869
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:529946021"
     variation       870..880
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcccatgggt"
                     /db_xref="dbSNP:745480462"
     variation       871
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1281107964"
     variation       878
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209058851"
     variation       880
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764571884"
     variation       885
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370761964"
     variation       892
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775876318"
     variation       900
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144449264"
     variation       902
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772782540"
     variation       907
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1330502209"
     variation       911
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769304167"
     variation       915
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006268708"
     variation       918
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747665958"
     variation       921
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868295626"
     variation       926
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143131956"
     variation       930
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199650198"
     variation       931
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1026307269"
     variation       935
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768514532"
     variation       936
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746941491"
     variation       937
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1292858286"
     variation       940
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210252921"
     variation       941
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1555350163"
     variation       944
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139800030"
     variation       945
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758228717"
     variation       951
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781096873"
     variation       952
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977939396"
     variation       953
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358330775"
     variation       955
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1284735568"
     variation       956
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993488539"
     variation       957
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363170287"
     variation       966..971
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caacca"
                     /db_xref="dbSNP:1555350156"
     variation       966
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322804815"
     variation       969
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750679604"
     variation       970
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364445625"
     variation       974
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867979918"
     variation       979
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290281755"
     variation       984
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:779220317"
     variation       994
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1321908772"
     variation       1011
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1407465215"
     variation       1013
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1164601677"
     variation       1018
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78559885"
     variation       1027
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201396096"
     variation       1031
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:764205900"
     variation       1032
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:964796364"
     variation       1034
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1566622143"
     variation       1049
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017328977"
     variation       1053
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761138937"
     variation       1059
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753156713"
     variation       1060
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759833842"
     variation       1068
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774680300"
     variation       1072
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1219049095"
     variation       1083
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370275924"
     variation       1086
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776053080"
     variation       1087
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204435968"
     variation       1091
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:171978"
     variation       1092
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340168757"
     variation       1098..1102
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tttt"
                     /replace="ttttt"
                     /replace="tttttt"
                     /db_xref="dbSNP:1197615289"
     variation       1100
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299838408"
     variation       1101
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192883185"
     variation       1103
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:889592710"
     variation       1106
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229234977"
     variation       1107
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780072062"
     variation       1108
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273316573"
     variation       1109
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457686689"
     variation       1111
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772006682"
     variation       1115
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182392988"
     variation       1121
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1245381513"
     variation       1122
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3742576"
     variation       1123
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866064360"
     variation       1124
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:558072316"
     variation       1125..1127
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1566622028"
     variation       1125
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485650070"
     variation       1127
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757464106"
     variation       1132
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428446118"
     variation       1137
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993744729"
     variation       1139
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:907483952"
     variation       1156
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329597774"
     variation       1160..1163
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1398080713"
     variation       1169
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1463821799"
     variation       1170
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465056084"
     variation       1183
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337262345"
     variation       1192
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399289149"
     variation       1202
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:575988911"
     variation       1205
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:555242082"
     variation       1206
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561466216"
     variation       1207
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750146313"
     variation       1213
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1190100508"
     variation       1216
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229755388"
     variation       1221
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894481205"
     variation       1227
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543291377"
     variation       1228
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1478094910"
     variation       1233
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482490326"
     variation       1234
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:928301679"
     variation       1237
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:981657803"
     variation       1239
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1255131942"
     variation       1241
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75947588"
     variation       1244
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764880954"
     variation       1246
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195329294"
     variation       1254
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420874693"
     variation       1256
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477169612"
     variation       1259
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:916081360"
     variation       1260
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1360812788"
     variation       1278
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464414724"
     variation       1284
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:985397680"
     variation       1288
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:952150059"
     variation       1300
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050559"
     variation       1304
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1402106303"
     variation       1308
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026840321"
     variation       1309
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903692952"
     variation       1311
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224139958"
     variation       1329
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042235855"
     variation       1332
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:945281239"
     variation       1335
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923213099"
     variation       1337..1344
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caaaagca"
                     /db_xref="dbSNP:976420913"
     variation       1342
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:553969803"
     variation       1343
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972142607"
     variation       1349
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:943019365"
     variation       1354
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538805998"
     variation       1355
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1487017770"
     variation       1358
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1218381719"
     variation       1362
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1260532137"
     variation       1371
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487705519"
     variation       1373
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199472030"
     variation       1389
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1427268662"
     variation       1397
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142727455"
     variation       1402
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1219845536"
     variation       1418
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984556416"
     variation       1419
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951811707"
     variation       1420
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556614831"
     variation       1421
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:3215889"
     variation       1422
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:869122184"
     variation       1422
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350067"
     variation       1423
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889740596"
     variation       1426
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:537889967"
     variation       1431
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281712076"
     variation       1434
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1028147110"
     variation       1437
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295354677"
     variation       1440
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567634820"
     variation       1447
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219167817"
     variation       1452
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331775492"
     variation       1458
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971574768"
     variation       1464
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1024531987"
     variation       1468
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372333803"
     variation       1469
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1013593016"
     variation       1478
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011851024"
     variation       1485
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621702"
     variation       1489
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357328033"
     variation       1495
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175318513"
     variation       1498
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164324256"
     variation       1503
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566621689"
     variation       1505
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778705827"
     variation       1507
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414498885"
     variation       1508
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761387465"
     variation       1515
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1052830345"
     variation       1517
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190556214"
     variation       1533
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:894436849"
     variation       1541
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1033466446"
     variation       1543
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1251091564"
     variation       1544
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934406906"
     variation       1552
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621652"
     variation       1561
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1441364759"
     variation       1571..1576
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgattg"
                     /db_xref="dbSNP:149455658"
     variation       1572
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369779296"
     variation       1581
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438677729"
     variation       1584
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903304073"
     variation       1590
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754230866"
     variation       1602
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1042182924"
     variation       1607
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1045463851"
     variation       1612
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435793143"
     variation       1618
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868860898"
     variation       1624
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948990605"
     variation       1625
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945186505"
     variation       1627
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379724611"
     variation       1637
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:916180198"
     variation       1641..1646
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caatca"
                     /db_xref="dbSNP:1179283220"
     variation       1646..1647
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1482497443"
     variation       1647..1654
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gtgtgt"
                     /replace="gtgtgtgt"
                     /db_xref="dbSNP:886050558"
     variation       1647
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901684336"
     variation       1654
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228539728"
     variation       1659
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291528909"
     variation       1662
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319424226"
     variation       1663
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237362268"
     variation       1666
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251855513"
     variation       1676
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764392879"
     variation       1686..1689
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1176602266"
     variation       1696
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211453769"
     variation       1698
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040254525"
     variation       1704..1707
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1486654604"
     variation       1704
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:984960530"
     variation       1710
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283965626"
     variation       1711
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411874833"
     variation       1714
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536571793"
     variation       1719
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1239590153"
     variation       1724
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:930784453"
     variation       1728
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050557"
     variation       1729
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886050556"
     variation       1730
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972087134"
     variation       1731
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966101197"
     variation       1734..1735
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1331182993"
     variation       1735
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984894491"
     variation       1748
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184421963"
     variation       1757
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376736111"
     variation       1758
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56245644"
     variation       1761
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1376475442"
     variation       1762
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227306464"
     variation       1771
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986127085"
     variation       1772
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621429"
     variation       1773..1784
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ttataa"
                     /replace="ttataattataa"
                     /db_xref="dbSNP:971821568"
     variation       1775
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1319311232"
     variation       1778
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196710335"
     variation       1779
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:58246365"
     variation       1780
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1257294974"
     variation       1787
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448679301"
     variation       1795
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211938034"
     variation       1803
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192422162"
     variation       1810
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472585406"
     variation       1823
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1028682339"
     variation       1845
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775857186"
     variation       1847
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295783908"
     variation       1848
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1024896852"
     variation       1859
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:957402368"
     variation       1860
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138197536"
     variation       1862
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:998603699"
     variation       1869
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332601359"
     variation       1883
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906986413"
     variation       1885
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045412281"
     variation       1893
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1013022875"
     variation       1901..1904
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1298354320"
     variation       1903
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187055500"
     variation       1909
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772253161"
     variation       1911
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341863555"
     variation       1914
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216233957"
     variation       1924
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422373370"
     variation       1939
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:549838567"
     variation       1979
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1345627274"
     variation       1991
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220796650"
     variation       2000
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74517617"
     variation       2001
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80140046"
     variation       2002
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78935901"
     variation       2003
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759551235"
     variation       2004..2008
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcgt"
                     /db_xref="dbSNP:1000175646"
     variation       2004
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1441567214"
     variation       2006
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781146554"
     variation       2007
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036526594"
     variation       2014
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886050555"
     variation       2015
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192998502"
     variation       2021
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430693238"
     variation       2039
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767628237"
     variation       2044
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1215947126"
     variation       2045
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944782027"
     variation       2046
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488676963"
     variation       2047
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57390094"
     variation       2048
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967368837"
     variation       2052..2053
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1298489300"
     variation       2053
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912005555"
     variation       2088
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986130839"
     variation       2089
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184224534"
     variation       2097
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228720148"
     variation       2107
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020294698"
     variation       2109
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:998230048"
ORIGIN      
gctctttttaagttagtgctggaacgtggaagagctgctgcctccgaagcagtaaaccagcccctctgtttgtttgtttgctttgcccttagttccactgctccaaacccacccaccaaggactctgaacctgtccaccccgggcgcatcaagatcttccagctgggtacccccgatttgggccgactttgcacctccaaacaaccttagcatgatgtcttatcttaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcgggtatggacttgctgcacccctccgtgggctacccggccaccccccggaaacagcgccgggagaggacgacgttcactcgggcgcagctagatgtgctggaagcactgtttgccaagacccggtacccagacatcttcatgcgagaggaggtggcactgaaaatcaacttgcccgagtcgagggtgcaggtatggtttaagaatcgaagagctaagtgccgccaacaacagcaacaacagcagaatggaggtcaaaacaaagtgagacctgccaaaaagaagacatctccagctcgggaagtgagttcagagagtggaacaagtggccaattcactcccccctctagcacctcagtcccgaccattgccagcagcagtgctcctgtgtctatctggagcccagcttccatctccccactgtcagatcccttgtccacctcctcttcctgcatgcagaggtcctatcccatgacctatactcaggcttcaggttatagtcaaggatatgctggctcaacttcctactttgggggcatggactgtggatcatatttgacccctatgcatcaccagcttcccggaccaggggccacactcagtcccatgggtaccaatgcagtcaccagccatctcaatcagtccccagcttctctttccacccagggatatggagcttcaagcttgggttttaactcaaccactgattgcttggattataaggaccaaactgcctcctggaagcttaacttcaatgctgactgcttggattataaagatcagacatcctcgtggaaattccaggttttgtgaagacctgtagaacctctttttgtgggtgatttttaaatatactgggctggacattccagttttagccaggcattggttaaaagagttagatgggatgatgctcagactcatctgatcaaagttccgagaggcatagaaggaaaaacgaagggccttagaggggcctacaaaccagcaacatgaaatggacaaaccaatctgcttaagatcctgtcatagttttagatcattggttatcctgatttgcaaagtgatcaaaagcattctagccatgtgcaaccaaacaccaccaaaaataaaatcaaacaaaactaagttgtgaaggaagggagggaaggtcatagccttcttaagcagaggtgttccattgttttagccaatccttggttgaatcttaggaatgaacagtgtctcaagctcattcacgtttcatgaccaactggtagttggcactgaaaaaacttttcagggctgtgtgaattgtgtgactgattgtcctagatgcactactttatttaaaaaataatgttcataaggagtcaatatgtagtttaagagacaatcagtgtgtgtcttataaatggtacatctgtggtttttaatctgtgctagacttcaaaactgtgatctcctgttattgtatgcaaccttgaactccacctctgcaggggttcttctgtgattaaataggttataattataagcaaaattcagagcaactgagtactgatctaaaaagattacctttggctggaggtgagctgcactgaaactttacgacaaaatgtctctggacaaagagagtcagagaagagaagcaaaaggacactaattcatctgtaatttactgttggtaagcctagcagtaaagagacattggtcaattgctctgaccctgatgaattattaaactgagatcattgtcgtttatgcttgcagatgttaaatggaaaagttatatatgcataaaccttttcttcctggatttggcagatatgtataattatattaaaatggttctagcacaacattgggtccagtttaattttacaccgctatttatgaataagaagcctacattcagcctttcctccccaaaacacgtttttcttaggacagagagtaaattagcaaacttatttttactttttttttttgctaatctatgcataaaatagatatgaatgacagtggtaggtagactttttgtgactttcatcaggattgctctgaaattgagtttggagagcctaacaacaagatcttgttttccttgcttttccctccctacttcaaacctgaacgatttcttaggcactttattagaatgttttaaaatatatcaagtttttaagagggaggaggagaattggagtatctctgaaaacatgagaatgacaagaatttcttgttactattctcttatttgattaaggggattttttttttttaacttccaaaaactgaggtaaacatgagagggagtgtaatcagaatctgaaagtaattcaggcagaaatgattcctgaacaaaagagtttcagaaaagttttaaaacctataatttcagtagttgaacataaggcaccctggtcagtttgtgtgtatgtgtttaagaaagtgccgagggggaaaaaatgggtcccttttcagttgtacctgcattttgtaaaccagtcaccagaaaagacaaatgggccaatgatcatggtgctcctcaggtaaaagcaatatttaatttcattttaagctgcttaagctcttacagctgaccaaaattaagtgactcttgattgtaacgttttaaatgaaggttagcagttgcaacca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]