GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 04:17:39, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_172213               1014 bp    mRNA    linear   PRI 31-MAY-2019
DEFINITION  Homo sapiens CD8b molecule (CD8B), transcript variant 2, mRNA.
ACCESSION   NM_172213
VERSION     NM_172213.4
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1014)
  AUTHORS   Liu D, Hu Y, Guo Y, Zhu Z, Lu B, Wang X and Huang Y.
  TITLE     Mycoplasma-associated multidrug resistance of hepatocarcinoma cells
            requires the interaction of P37 and Annexin A2
  JOURNAL   PLoS ONE 12 (10), e0184578 (2017)
   PUBMED   28976984
  REMARK    GeneRIF: results suggest that mycoplasma induces a resistance to
            multiple drugs in hepatocarcinoma cells which required the
            interaction of P37 and Annexin A2. The pathway downstream this
            interaction needs to be explored
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1014)
  AUTHORS   Pascual-Garcia M, Bertolo C, Nieto JC, Serrat N, Espinosa I,
            D'Angelo E, Munoz R, Rovira R, Vidal S and Prat J.
  TITLE     CD8 down-regulation on cytotoxic T lymphocytes of patients with
            endometrioid endometrial carcinomas
  JOURNAL   Hum. Pathol. 56, 180-188 (2016)
   PUBMED   27346574
  REMARK    GeneRIF: Endometrioid endometrial carcinomas are capable of
            down-regulating CD8 expression by cytotoxic T lymphocytes.
REFERENCE   3  (bases 1 to 1014)
  AUTHORS   Hedrich CM, Crispin JC, Rauen T, Ioannidis C, Koga T, Rodriguez
            Rodriguez N, Apostolidis SA, Kyttaris VC and Tsokos GC.
  TITLE     cAMP responsive element modulator (CREM) alpha mediates chromatin
            remodeling of CD8 during the generation of CD3+ CD4- CD8- T cells
  JOURNAL   J. Biol. Chem. 289 (4), 2361-2370 (2014)
   PUBMED   24297179
  REMARK    GeneRIF: CREMalpha orchestrates epigenetic remodeling of the CD8A,B
            through the recruitment of DNA methyltransferase (DNMT) 3a and
            histone methyltransferase G9a.
REFERENCE   4  (bases 1 to 1014)
  AUTHORS   Hedrich CM, Rauen T, Crispin JC, Koga T, Ioannidis C, Zajdel M,
            Kyttaris VC and Tsokos GC.
  TITLE     cAMP-responsive element modulator alpha (CREMalpha) trans-represses
            the transmembrane glycoprotein CD8 and contributes to the
            generation of CD3+CD4-CD8- T cells in health and disease
  JOURNAL   J. Biol. Chem. 288 (44), 31880-31887 (2013)
   PUBMED   24047902
  REMARK    GeneRIF: transcription factor cAMP-responsive element modulator
            alpha (CREMalpha), which is expressed at increased levels in T
            cells from systemic lupus erythematosus patients, contributes to
            transcriptional silencing of CD8A and CD8B.
REFERENCE   5  (bases 1 to 1014)
  AUTHORS   Thakral D, Dobbins J, Devine L and Kavathas PB.
  TITLE     Differential expression of the human CD8beta splice variants and
            regulation of the M-2 isoform by ubiquitination
  JOURNAL   J. Immunol. 180 (11), 7431-7442 (2008)
   PUBMED   18490743
  REMARK    GeneRIF: study demonstrated differential mRNA expression patterns
            of CD8beta splice variants in thymocytes and in resting, memory,
            and activated primary CD8(+) T cells
REFERENCE   6  (bases 1 to 1014)
  AUTHORS   Nakayama K, Kawachi Y, Tokito S, Minami N, Yamamoto R, Imai T,
            Gachelin G and Nakauchi H.
  TITLE     Recent duplication of the two human CD8 beta-chain genes
  JOURNAL   J. Immunol. 148 (6), 1919-1927 (1992)
   PUBMED   1541829
REFERENCE   7  (bases 1 to 1014)
  AUTHORS   Terry LA, DiSanto JP, Small TN and Flomenberg N.
  TITLE     Differential expression and regulation of the human CD8 alpha and
            CD8 beta chains
  JOURNAL   Tissue Antigens 35 (2), 82-91 (1990)
   PUBMED   2111591
REFERENCE   8  (bases 1 to 1014)
  AUTHORS   Parnes JR.
  TITLE     Molecular biology and function of CD4 and CD8
  JOURNAL   Adv. Immunol. 44, 265-311 (1989)
   PUBMED   2493728
  REMARK    Review article
REFERENCE   9  (bases 1 to 1014)
  AUTHORS   Norment AM and Littman DR.
  TITLE     A second subunit of CD8 is expressed in human T cells
  JOURNAL   EMBO J. 7 (11), 3433-3439 (1988)
   PUBMED   3145195
REFERENCE   10 (bases 1 to 1014)
  AUTHORS   Johnson,P.
  TITLE     A human homolog of the mouse CD8 molecule, Lyt-3: genomic sequence
            and expression
  JOURNAL   Immunogenetics 26 (3), 174-177 (1987)
   PUBMED   3114136
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC405359.1, BC100912.2,
            BC100913.1 and AW296309.1.
            On May 31, 2019 this sequence version replaced NM_172213.3.
            
            Summary: The CD8 antigen is a cell surface glycoprotein found on
            most cytotoxic T lymphocytes that mediates efficient cell-cell
            interactions within the immune system. The CD8 antigen, acting as a
            coreceptor, and the T-cell receptor on the T lymphocyte recognize
            antigens displayed by an antigen presenting cell (APC) in the
            context of class I MHC molecules. The functional coreceptor is
            either a homodimer composed of two alpha chains, or a heterodimer
            composed of one alpha and one beta chain. Both alpha and beta
            chains share significant homology to immunoglobulin variable light
            chains. This gene encodes the CD8 beta chain isoforms. Multiple
            alternatively spliced transcript variants encoding distinct
            membrane associated or secreted isoforms have been described. A
            pseudogene, also located on chromosome 2, has been identified.
            [provided by RefSeq, May 2010].
            
            Transcript Variant: This variant (2) encodes the longest isoform
            (2).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR7410570.205416.1,
                                           SRR7410570.205417.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2153932, SAMEA2467150
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-45                DC405359.1         39-83
            46-46               BC100912.2         75-75
            47-803              BC100913.1         76-832
            804-1014            AW296309.1         23-233              c
FEATURES             Location/Qualifiers
     source          1..1014
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p11.2"
     gene            1..1014
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /note="CD8b molecule"
                     /db_xref="GeneID:926"
                     /db_xref="HGNC:HGNC:1707"
                     /db_xref="MIM:186730"
     exon            1..64
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1447991156"
     variation       2
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1209913782"
     variation       3
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270648543"
     variation       6
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460249516"
     variation       9
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1183422913"
     variation       14
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1257090791"
     variation       19
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1357889018"
     CDS             22..753
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /note="isoform 2 precursor is encoded by transcript
                     variant 2; CD8 antigen, beta polypeptide 1 (p37); T
                     lymphocyte surface glycoprotein beta chain"
                     /codon_start=1
                     /product="T-cell surface glycoprotein CD8 beta chain
                     isoform 2 precursor"
                     /protein_id="NP_757362.1"
                     /db_xref="CCDS:CCDS1995.1"
                     /db_xref="GeneID:926"
                     /db_xref="HGNC:HGNC:1707"
                     /db_xref="MIM:186730"
                     /translation="
MRPRLWLLLAAQLTVLHGNSVLQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILKT"
     sig_peptide     22..84
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
     mat_peptide     85..750
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /product="T-cell surface glycoprotein CD8 beta chain
                     isoform 2"
     misc_feature    106..423
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /note="Immunoglobulin (Ig) like domain of CD8 beta chain;
                     Region: IgV_CD8_beta; cd07700"
                     /db_xref="CDD:319326"
     misc_feature    order(178..180,190..192,220..222,226..228,376..378,
                     397..402)
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:319326"
     variation       25
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274868984"
     variation       29
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1027597679"
     variation       31
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750345715"
     variation       32
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:964575377"
     variation       33
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430421448"
     variation       36
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1454430122"
     variation       37
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1370189782"
     variation       39
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767490181"
     variation       40
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1167021963"
     variation       43
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1446657426"
     variation       45
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1415759508"
     variation       46
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:62146888"
     variation       47
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751398411"
     variation       48
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1235619545"
     variation       49
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1206703754"
     variation       50
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483060992"
     variation       51
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1468008784"
     variation       52
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1273262945"
     variation       53
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202642059"
     variation       54
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1323111327"
     variation       55
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1313919313"
     variation       56
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1228056594"
     variation       57
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763600265"
     variation       60
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:539876702"
     variation       62
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379382102"
     variation       64
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1281715212"
     exon            65..424
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /inference="alignment:Splign:2.1.0"
     variation       65
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440421078"
     variation       71
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368650240"
     variation       72
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137953763"
     variation       73
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229601797"
     variation       79
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1350377646"
     variation       80
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1286567328"
     variation       85
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146795196"
     variation       90
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1394552067"
     variation       96
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1368593220"
     variation       100
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1293097913"
     variation       101
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391620375"
     variation       102
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454793841"
     variation       105
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1434579280"
     variation       108
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:755027423"
     variation       111
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140325048"
     variation       114
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781065396"
     variation       115
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1427222469"
     variation       123
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757205779"
     variation       126
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751251633"
     variation       127
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763949278"
     variation       128
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:953935080"
     variation       131
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758188273"
     variation       132
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400837734"
     variation       136
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752375575"
     variation       140
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371965937"
     variation       142
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1190328641"
     variation       143
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1487289172"
     variation       144
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759079246"
     variation       145
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753422558"
     variation       147
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766934978"
     variation       148
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1277076160"
     variation       155
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761248929"
     variation       160
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1558764127"
     variation       161
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:761178966"
     variation       162
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200858779"
     variation       165
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1235522049"
     variation       172
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11558603"
     variation       173
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772468080"
     variation       186
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762132342"
     variation       190
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1212023507"
     variation       193
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774522740"
     variation       194
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184840038"
     variation       198
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435468863"
     variation       199
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1248329743"
     variation       201
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:200478508"
     variation       202
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967089228"
     variation       203
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140127269"
     variation       204
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769835949"
     variation       206
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1377748160"
     variation       207
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746956335"
     variation       210
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200182639"
     variation       212
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1391581209"
     variation       215
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1189628254"
     variation       220
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758184342"
     variation       222
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752467151"
     variation       223
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:576844921"
     variation       225
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754692260"
     variation       228..236
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="cct"
                     /replace="cctggccct"
                     /db_xref="dbSNP:775974496"
     variation       231
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753332620"
     variation       233
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765982501"
     variation       234
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145473020"
     variation       235
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1486058695"
     variation       237
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1324966307"
     variation       239
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142966127"
     variation       241
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767948136"
     variation       246
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139740563"
     variation       247
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150505433"
     variation       250
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397756224"
     variation       253
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1402775866"
     variation       255
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1342745930"
     variation       261
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:768805598"
     variation       264
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144849882"
     variation       265
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775751696"
     variation       266
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:866734476"
     variation       267
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769898834"
     variation       273
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:949845224"
     variation       276
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211917687"
     variation       279
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:896939012"
     variation       281
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1446544258"
     variation       282
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777728790"
     variation       283
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1192831331"
     variation       286..287
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1189999005"
     variation       290
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424922092"
     variation       300
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771926098"
     variation       301
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747895168"
     variation       302
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201066720"
     variation       303
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753527031"
     variation       308
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310724979"
     variation       310
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779620836"
     variation       313
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755618216"
     variation       314
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768017195"
     variation       315
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138659548"
     variation       319
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:751852075"
     variation       323
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1311840738"
     variation       326
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1412857667"
     variation       327
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1363036924"
     variation       336
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764433373"
     variation       337
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367817222"
     variation       341
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775661607"
     variation       344
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1393805545"
     variation       345
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1349990678"
     variation       347
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765411219"
     variation       348
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1458670582"
     variation       358
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1368246577"
     variation       364
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1217481298"
     variation       371
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759614077"
     variation       375
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1473844682"
     variation       376
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375735227"
     variation       378
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:568268878"
     variation       379
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:774487455"
     variation       384
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1292222752"
     variation       387
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768549471"
     variation       388
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749133219"
     variation       389
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779715103"
     variation       390
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1213819919"
     variation       395
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755741417"
     variation       399
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755373342"
     variation       400
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1288449111"
     variation       403
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:780567812"
     variation       404
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756823674"
     variation       405
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1325190945"
     variation       406
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752042896"
     variation       409
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:373675213"
     variation       419
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758724392"
     variation       421
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459313578"
     variation       423
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753085425"
     exon            425..514
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /inference="alignment:Splign:2.1.0"
     variation       435
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:756733708"
     variation       440
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1269073760"
     variation       444
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1054559639"
     variation       444
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746555795"
     variation       445
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778207004"
     variation       448
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1346400640"
     variation       457
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477843313"
     variation       458
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393437091"
     variation       459
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1236954644"
     variation       462
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:758920524"
     variation       467
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1466137625"
     variation       468
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248392925"
     variation       477
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1428088634"
     variation       488
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372481831"
     variation       489
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:937257361"
     variation       490
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:927235282"
     variation       492
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1376992812"
     variation       498
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1445179093"
     variation       500..502
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace=""
                     /replace="cag"
                     /db_xref="dbSNP:1388113471"
     variation       502
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280165923"
     variation       503
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779140383"
     variation       504
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1200482037"
     variation       513
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1343872067"
     variation       514
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755429597"
     exon            515..604
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /inference="alignment:Splign:2.1.0"
     variation       519
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:923186345"
     variation       520
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1182440187"
     variation       522
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412914606"
     variation       523
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748590037"
     variation       527
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1459000089"
     variation       529
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779524372"
     variation       530
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755267048"
     variation       532
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1126875"
     variation       535
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780373127"
     variation       537
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448928822"
     variation       538
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756415770"
     variation       540
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374556219"
     variation       542
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1323953702"
     variation       544
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750458820"
     variation       546
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1233266019"
     variation       549
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333267958"
     variation       551
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329650144"
     variation       553
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1290326750"
     variation       554
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767697125"
     variation       557
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1350115409"
     variation       558
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368685988"
     variation       559
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2228022"
     variation       565
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1351443231"
     variation       569
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165184623"
     variation       570
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1210210519"
     variation       571
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1239681302"
     variation       573
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1460875332"
     variation       580
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765255189"
     variation       586
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759205868"
     variation       588
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1182155743"
     variation       589
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:958802421"
     variation       590
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472668619"
     variation       593
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776426409"
     variation       594
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1126874"
     variation       601
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424744358"
     exon            605..641
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /inference="alignment:Splign:2.1.0"
     variation       607
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:897219748"
     variation       608
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142328928"
     variation       610
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751687141"
     variation       611
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765031706"
     variation       613
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145406454"
     variation       618
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1232370733"
     variation       620
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1368571744"
     variation       622
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299523629"
     variation       623
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382734272"
     variation       625
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753839701"
     variation       626
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766148662"
     variation       628
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:932889775"
     variation       629
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151294448"
     variation       630
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273077002"
     variation       631
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1359222834"
     variation       633
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1233008929"
     variation       637
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867221419"
     variation       641
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772821597"
     exon            642..1014
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /inference="alignment:Splign:2.1.0"
     variation       643
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1171775421"
     variation       645
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:949181967"
     variation       649
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:955526509"
     variation       650
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1190103195"
     variation       652
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1405194910"
     variation       656
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:769986478"
     variation       658
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35555413"
     variation       659
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1208998264"
     variation       660
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482178837"
     variation       661
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:549725584"
     variation       663
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252831599"
     variation       668
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1228094829"
     variation       675..679
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="cccc"
                     /replace="ccccc"
                     /replace="cccccc"
                     /db_xref="dbSNP:767983404"
     variation       675
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139050200"
     variation       676
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1359920070"
     variation       678
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450488067"
     variation       680
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771961718"
     variation       681
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:530502587"
     variation       686
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778660499"
     variation       689
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754601961"
     variation       692..702
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace=""
                     /replace="gatactacagc"
                     /db_xref="dbSNP:1252338007"
     variation       694..699
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="tac"
                     /replace="tactac"
                     /db_xref="dbSNP:1558744611"
     variation       695
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748762924"
     variation       696
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:956326398"
     variation       698
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1393899908"
     variation       700
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779424600"
     variation       704
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1031932537"
     variation       709
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755706334"
     variation       710
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198450634"
     variation       711
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:978987767"
     variation       713
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868315171"
     variation       714
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1442593069"
     variation       719
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1461946688"
     variation       726
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:141630292"
     variation       727
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1167723654"
     variation       732
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78639210"
     variation       733
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1472011934"
     variation       735
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1417218008"
     variation       736
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1186144128"
     variation       740
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768048664"
     variation       751
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252445900"
     variation       753..754
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1479759661"
     variation       755
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201843972"
     variation       760
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112206560"
     variation       762
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751941920"
     variation       770
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256141203"
     variation       775
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426370069"
     variation       778
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763085399"
     variation       790
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1416347275"
     variation       792..795
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:759997422"
     variation       794
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753025415"
     variation       804
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:765213884"
     variation       808
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:55989978"
     variation       811
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:559459095"
     variation       812
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:930083436"
     variation       817
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:897791327"
     variation       818
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:920049103"
     variation       824
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1426012042"
     variation       825
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1038767501"
     variation       835
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1037599052"
     variation       838
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220584261"
     variation       839
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1191684844"
     variation       844
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:941922936"
     variation       847
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1482525986"
     variation       849
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:905101320"
     variation       850
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:911422326"
     variation       862
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1045343337"
     variation       863
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:949240641"
     variation       867
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934117540"
     variation       868
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1244726152"
     variation       871
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1247648963"
     variation       883
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775938230"
     variation       895
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:924124022"
     variation       897
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978278939"
     variation       898
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772260822"
     variation       904
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1430683899"
     variation       906
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1170514847"
     variation       911
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967519107"
     variation       916
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1363844688"
     variation       923
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1214082147"
     variation       926
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384975507"
     variation       928
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322888229"
     variation       929
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1331623796"
     variation       930
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746418366"
     variation       932
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62146080"
     variation       934
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1558744452"
     variation       955
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021408474"
     variation       963
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1340956463"
     variation       963
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1301417709"
     variation       964
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1219101231"
     variation       969
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1366149619"
     variation       970
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1276114096"
     variation       971
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1353723752"
     variation       979
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370648650"
     variation       992
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280431265"
     variation       994
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1400981664"
     variation       995
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564674066"
     variation       996
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180908054"
     variation       1003
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1436872271"
     variation       1004
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1359766243"
     variation       1005
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1453840862"
     variation       1008
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1187025821"
     variation       1011
                     /gene="CD8B"
                     /gene_synonym="CD8B1; LEU2; LY3; LYT3; P37"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189332887"
ORIGIN      
aggtgtcccgggcgcgccacgatgcggccgcggctgtggctcctcttggccgcgcagctgacagttctccatggcaactcagtcctccagcagacccctgcatacataaaggtgcaaaccaacaagatggtgatgctgtcctgcgaggctaaaatctccctcagtaacatgcgcatctactggctgagacagcgccaggcaccgagcagtgacagtcaccacgagttcctggccctctgggattccgcaaaagggactatccacggtgaagaggtggaacaggagaagatagctgtgtttcgggatgcaagccggttcattctcaatctcacaagcgtgaagccggaagacagtggcatctacttctgcatgatcgtcgggagccccgagctgaccttcgggaagggaactcagctgagtgtggttgatttccttcccaccactgcccagcccaccaagaagtccaccctcaagaagagagtgtgccggttacccaggccagagacccagaagggcccactttgtagccccatcacccttggcctgctggtggctggcgtcctggttctgctggtttccctgggagtggccatccacctgtgctgccggcggaggagagcccggcttcgtttcatgaaacagcctcaaggggaaggtatatcaggaacctttgtcccccaatgcctgcatggatactacagcaatactacaacctcacagaagctgcttaacccatggatcctgaaaacataggcaagaagcacaggtcctgatgagtggatctttactacttttaccagattcctccctcgctcagagggatcctcccacacacccagcagagacttctctgccaccatcaaccccccaagtcatagggggctcaagttctgccctggtgagctgtggcccccatccttgtgaaccccaaagtgtcccccttgtggaaccaaatgtatccatcttgaataaatttgcccaaaatcctaaagaccgggaaaagggaaccattga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]