2024-04-25 11:22:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_139036 1890 bp mRNA linear ROD 20-MAR-2023 DEFINITION Rattus norvegicus LIM homeobox 5 (Lhx5), mRNA. ACCESSION NM_139036 VERSION NM_139036.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1890) AUTHORS Zhao Y, Kwan KM, Mailloux CM, Lee WK, Grinberg A, Wurst W, Behringer RR and Westphal H. TITLE LIM-homeodomain proteins Lhx1 and Lhx5, and their cofactor Ldb1, control Purkinje cell differentiation in the developing cerebellum JOURNAL Proc Natl Acad Sci U S A 104 (32), 13182-13186 (2007) PUBMED 17664423 REFERENCE 2 (bases 1 to 1890) AUTHORS Pillai A, Mansouri A, Behringer R, Westphal H and Goulding M. TITLE Lhx1 and Lhx5 maintain the inhibitory-neurotransmitter status of interneurons in the dorsal spinal cord JOURNAL Development 134 (2), 357-366 (2007) PUBMED 17166926 REFERENCE 3 (bases 1 to 1890) AUTHORS Zhao Y, Sheng HZ, Amini R, Grinberg A, Lee E, Huang S, Taira M and Westphal H. TITLE Control of hippocampal morphogenesis and neuronal differentiation by the LIM homeobox gene Lhx5 JOURNAL Science 284 (5417), 1155-1158 (1999) PUBMED 10325223 REFERENCE 4 (bases 1 to 1890) AUTHORS Tsuchida T, Ensini M, Morton SB, Baldassare M, Edlund T, Jessell TM and Pfaff SL. TITLE Topographic organization of embryonic motor neurons defined by expression of LIM homeobox genes JOURNAL Cell 79 (6), 957-970 (1994) PUBMED 7528105 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JACYVU010000228.1. On Dec 5, 2020 this sequence version replaced NM_139036.1. ##Evidence-Data-START## Transcript exon combination :: L35572.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760433, SAMN14984038 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-510 JACYVU010000228.1 5339529-5340038 c 511-734 JACYVU010000228.1 5337312-5337535 c 735-1012 JACYVU010000228.1 5336428-5336705 c 1013-1178 JACYVU010000228.1 5335598-5335763 c 1179-1890 JACYVU010000228.1 5331599-5332310 c FEATURES Location/Qualifiers source 1..1890 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="12" /map="12q16" gene 1..1890 /gene="Lhx5" /note="LIM homeobox 5" /db_xref="GeneID:124451" /db_xref="RGD:71079" exon 1..510 /gene="Lhx5" /inference="alignment:Splign:2.1.0" misc_feature 248..250 /gene="Lhx5" /note="upstream in-frame stop codon" CDS 338..1546 /gene="Lhx5" /note="LIM homeobox protein 5; homeobox protein LIM-2" /codon_start=1 /product="LIM/homeobox protein Lhx5" /protein_id="NP_620605.1" /db_xref="GeneID:124451" /db_xref="RGD:71079" /translation="
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRFGTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGPPSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHGADNPRFTDMISHPDTPSPEPGLPGALHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW"
misc_feature 350..505 /gene="Lhx5" /note="The first LIM domain of Lhx1 (also known as Lim1) and Lhx5; Region: LIM1_Lhx1_Lhx5; cd09367" /db_xref="CDD:188753" misc_feature order(350..352,359..361,413..415,422..424,431..433, 440..442,491..493,500..502) /gene="Lhx5" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:188753" misc_feature 527..694 /gene="Lhx5" /note="The second LIM domain of Lhx1 (also known as Lim1) and Lhx5; Region: LIM2_Lhx1_Lhx5; cd09375" /db_xref="CDD:188761" misc_feature order(527..529,536..538,593..595,602..604,611..613, 620..622,680..682,689..691) /gene="Lhx5" /note="Zn binding site [ion binding]; other site" /db_xref="CDD:188761" misc_feature 707..895 /gene="Lhx5" /note="propagated from UniProtKB/Swiss-Prot (P61376.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature order(878..892,896..898,947..949,965..967,1004..1006, 1010..1015,1022..1027,1031..1039,1043..1048) /gene="Lhx5" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 884..1045 /gene="Lhx5" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:425441" misc_feature order(884..886,893..895,1013..1015,1022..1027,1034..1036) /gene="Lhx5" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature <1076..>1513 /gene="Lhx5" /note="EBNA-3B; Provisional; Region: PHA03378" /db_xref="CDD:223065" misc_feature 1229..1543 /gene="Lhx5" /note="propagated from UniProtKB/Swiss-Prot (P61376.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 511..734 /gene="Lhx5" /inference="alignment:Splign:2.1.0" exon 735..1012 /gene="Lhx5" /inference="alignment:Splign:2.1.0" exon 1013..1178 /gene="Lhx5" /inference="alignment:Splign:2.1.0" exon 1179..1890 /gene="Lhx5" /inference="alignment:Splign:2.1.0" ORIGIN
cggcgcctccgccaaccgggaaagccgctcgccagtgccgaagccagcagccgccgaggacacctgctcgaagctggagcgagcgcccagacgcgacccgtgacatgaggctgtgaccgccgccgccctccacgccactctgggcagtgcagtgccaggccggagagcgtcggaggacttgaccccgagaagtcttggttgatctgtatcggactcgaccctaccgaagaccacagaccaggggggctgagagccacagcagcggggaccgagaggccctaagggcccaggggccccaaggaggacgaggcggcccgagccgccggggcgcgcggctatgatggtgcactgtgccggctgtgagcggcccatcctcgaccgctttctgctgaacgtgctggaccgcgcgtggcatatcaaatgtgttcaatgctgcgagtgcaaaaccaacctctcggagaagtgtttctcccgggagggcaagctgtactgtaaaaacgacttcttcaggcgctttggcacaaagtgcgccggctgtgcgcaaggtatctctcccagcgacctggtgcgcaaggcccggagcaaagtcttccacctcaactgcttcacctgcatggtgtgcaacaagcagctgtccaccggagaagaactctacgtgatcgacgagaacaagtttgtgtgcaaggacgactacttaagctcctctagtctcaaagagggaagcctcaactcagtgtcatcctgtacggaccgcagtttgtctccggacctccaagatccgttacaggacgaccccaaagagaccgacaactcgacctcatcggacaaggagaccgctaacaacgagaatgaggaacagaactccggcaccaaacggcgcggcccgcgcactaccatcaaggccaagcagctggagacgctcaaggcagccttcgcagccacgcccaagcccacgcgccacatccgcgaacagctggcacaagagaccggcctcaacatgagggtcattcaggtgtggtttcagaaccgaaggtccaaagaacgccgcatgaaacagctgagcgctctgggcgcccggagacacgccttcttccggagtccgcggcgcatgcgtcccctgggcggccgcttggacgagtctgagatgttggggtctaccccatatacttattatggagactaccaaagcgactactacgctccgggaggcaactacgatttcttcgcgcacggcccgccgtcgcaggcacagtctccggccgactcaagcttcttggcagcatcgggacctggctcgacgccgcttggcgcgctggaaccaccgctggctgggcctcacggcgcggacaaccctaggttcaccgacatgatctcgcacccggacacgcccagtccggagccaggcttgcccggagcgctgcaccccatgccgggagaggtgttcagcggcgggcccagcccgcccttccccatgagcggcaccagcggctacagcggacccctgtcgcaccccaatcctgagctcaacgaagcggccgtatggtaaggccgaggggccgagttgacccctgccaccaagccccggacgccgcctgggtaagccacaagagtcttctcttgagtttgcacccaccaggcaactcgcatcaccacccctcagagcttcggcacgcgcctgcacagtttctcgggaccaaagtcaatattctggagggtcgagattccaagcacaccctagaagccctccggacccccacccaaccatcacctctttgaattaagagggggaggggatgagacaaggaacggagatcgtggtactacccctccctgcgagccgaggcattgtggaatcctatttctcgctttctctttttaaaaaggaaggaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]