GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-19 12:33:35, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_133621               1070 bp    mRNA    linear   ROD 30-APR-2025
DEFINITION  Rattus norvegicus HOP homeobox (Hopx), mRNA.
ACCESSION   NM_133621
VERSION     NM_133621.3
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1070)
  AUTHORS   Kashyap,S., Rabbani,M., de Lima,I., Kondrachuk,O., Patel,R.,
            Shafiei,M.S., Mukker,A., Rajakumar,A. and Gupta,M.K.
  TITLE     HOPX Plays a Critical Role in Antiretroviral Drugs Induced
            Epigenetic Modification and Cardiac Hypertrophy
  JOURNAL   Cells 10 (12), 3458 (2021)
   PUBMED   34943964
  REMARK    GeneRIF: HOPX Plays a Critical Role in Antiretroviral Drugs Induced
            Epigenetic Modification and Cardiac Hypertrophy.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1070)
  AUTHORS   Trivedi,C.M., Zhu,W., Wang,Q., Jia,C., Kee,H.J., Li,L.,
            Hannenhalli,S. and Epstein,J.A.
  TITLE     Hopx and Hdac2 interact to modulate Gata4 acetylation and embryonic
            cardiac myocyte proliferation
  JOURNAL   Dev Cell 19 (3), 450-459 (2010)
   PUBMED   20833366
REFERENCE   3  (bases 1 to 1070)
  AUTHORS   Asanoma,K., Kato,H., Yamaguchi,S., Shin,C.H., Liu,Z.P., Kato,K.,
            Inoue,T., Miyanari,Y., Yoshikawa,K., Sonoda,K., Fukushima,K. and
            Wake,N.
  TITLE     HOP/NECC1, a novel regulator of mouse trophoblast differentiation
  JOURNAL   J Biol Chem 282 (33), 24065-24074 (2007)
   PUBMED   17576768
REFERENCE   4  (bases 1 to 1070)
  AUTHORS   Cheng,A., Shin-ya,K., Wan,R., Tang,S.C., Miura,T., Tang,H.,
            Khatri,R., Gleichman,M., Ouyang,X., Liu,D., Park,H.R., Chiang,J.Y.
            and Mattson,M.P.
  TITLE     Telomere protection mechanisms change during neurogenesis and
            neuronal maturation: newly generated neurons are hypersensitive to
            telomere and DNA damage
  JOURNAL   J Neurosci 27 (14), 3722-3733 (2007)
   PUBMED   17409236
REFERENCE   5  (bases 1 to 1070)
  AUTHORS   Kee,H.J., Kim,J.R., Nam,K.I., Park,H.Y., Shin,S., Kim,J.C.,
            Shimono,Y., Takahashi,M., Jeong,M.H., Kim,N., Kim,K.K. and Kook,H.
  TITLE     Enhancer of polycomb1, a novel homeodomain only protein-binding
            partner, induces skeletal muscle differentiation
  JOURNAL   J Biol Chem 282 (10), 7700-7709 (2007)
   PUBMED   17192267
REFERENCE   6  (bases 1 to 1070)
  AUTHORS   Kook,H., Lepore,J.J., Gitler,A.D., Lu,M.M., Wing-Man Yung,W.,
            Mackay,J., Zhou,R., Ferrari,V., Gruber,P. and Epstein,J.A.
  TITLE     Cardiac hypertrophy and histone deacetylase-dependent
            transcriptional repression mediated by the atypical homeodomain
            protein Hop
  JOURNAL   J Clin Invest 112 (6), 863-871 (2003)
   PUBMED   12975471
REFERENCE   7  (bases 1 to 1070)
  AUTHORS   Torrado,M., Lopez,E., Centeno,A., Medrano,C., Castro-Beiras,A. and
            Mikhailov,A.T.
  TITLE     Myocardin mRNA is augmented in the failing myocardium: expression
            profiling in the porcine model and human dilated cardiomyopathy
  JOURNAL   J Mol Med (Berl) 81 (9), 566-577 (2003)
   PUBMED   12920479
REFERENCE   8  (bases 1 to 1070)
  AUTHORS   Shin,C.H., Liu,Z.P., Passier,R., Zhang,C.L., Wang,D.Z.,
            Harris,T.M., Yamagishi,H., Richardson,J.A., Childs,G. and
            Olson,E.N.
  TITLE     Modulation of cardiac growth and development by HOP, an unusual
            homeodomain protein
  JOURNAL   Cell 110 (6), 725-735 (2002)
   PUBMED   12297046
REFERENCE   9  (bases 1 to 1070)
  AUTHORS   Chen,F., Kook,H., Milewski,R., Gitler,A.D., Lu,M.M., Li,J.,
            Nazarian,R., Schnepp,R., Jen,K., Biben,C., Runke,G., Mackay,J.P.,
            Novotny,J., Schwartz,R.J., Harvey,R.P., Mullins,M.C. and
            Epstein,J.A.
  TITLE     Hop is an unusual homeobox gene that modulates cardiac development
  JOURNAL   Cell 110 (6), 713-723 (2002)
   PUBMED   12297045
REFERENCE   10 (bases 1 to 1070)
  AUTHORS   Weaver,A.J., Sullivan,W.P., Felts,S.J., Owen,B.A. and Toft,D.O.
  TITLE     Crystal structure and activity of human p23, a heat shock protein
            90 co-chaperone
  JOURNAL   J Biol Chem 275 (30), 23045-23052 (2000)
   PUBMED   10811660
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000014.1.
            
            On Nov 25, 2020 this sequence version replaced NM_133621.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: FQ221225.1, FQ229504.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760383, SAMEA5760386
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-118               JAXUCZ010000014.1  31429413-31429530
            119-275             JAXUCZ010000014.1  31429656-31429812
            276-1070            JAXUCZ010000014.1  31436395-31437189
FEATURES             Location/Qualifiers
     source          1..1070
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="14"
                     /map="14p11"
     gene            1..1070
                     /gene="Hopx"
                     /gene_synonym="GIIg15b; Hod; Obl"
                     /note="HOP homeobox"
                     /db_xref="GeneID:171160"
                     /db_xref="RGD:621841"
     exon            1..118
                     /gene="Hopx"
                     /gene_synonym="GIIg15b; Hod; Obl"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    57..59
                     /gene="Hopx"
                     /gene_synonym="GIIg15b; Hod; Obl"
                     /note="upstream in-frame stop codon"
     exon            119..275
                     /gene="Hopx"
                     /gene_synonym="GIIg15b; Hod; Obl"
                     /inference="alignment:Splign:2.1.0"
     CDS             132..353
                     /gene="Hopx"
                     /gene_synonym="GIIg15b; Hod; Obl"
                     /note="odd homeobox 1; odd homeobox protein 1; global
                     ischemia-induced protein 15B; global ischemia-induced gene
                     15B protein; global ischemia induced protein GIIG15B;
                     homeobox only domain"
                     /codon_start=1
                     /product="homeodomain-only protein"
                     /protein_id="NP_598305.2"
                     /db_xref="GeneID:171160"
                     /db_xref="RGD:621841"
                     /translation="
MSAQTASGPTEDQVEILEYNFNKVNKHPDPTTLCLIAAEAGLTEEQTQKWFKQRLAEWRRSEGLPSECRSVTD"
     misc_feature    159..317
                     /gene="Hopx"
                     /gene_synonym="GIIg15b; Hod; Obl"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     exon            276..1070
                     /gene="Hopx"
                     /gene_synonym="GIIg15b; Hod; Obl"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
agccctgcgtgtgtcctcagtccttagggcagctccggacctccggaggcagctcttgaggagcttcctccactgtcccctcagagaggcaggcgagaggctctccatccttagccagacgctcacggaccatgtcggcgcagactgcgagcggccccacggaggaccaggtggagatcctggagtacaacttcaacaaggtcaacaagcaccccgaccccaccacgctgtgcctcatcgcagccgaggcgggcctcacggaggagcagacgcagaaatggtttaagcagcgcctggcggagtggcggcggtcagaaggcctgccttcggaatgcagatcggtcacggactagggagccaggcccttgagcttgctcccggaacttccgtgcctcagtttacccaggctgttttgatgtttcagtgcagtgttgaatgtctcattgtttgctgtcctgctgtttaacacaatgtgttttttgaatgtatataactaaagaaacaaaataacaggaagctaaatgcagttctgtgtaaagcgatggcttggccgggagaggggtgtggcttacgtttctctttggattttaatgaaagatgatgtgggagcagtttttgtttgcccttgaccgccactttccaatccgtatgtaccaccatccgtttcagagcattccagagctgcctggcttctgttgagaagttaaaggaacgggcaggcaggggagacacctcagtccaccttcctgtgcctctttcctccgcttcacttaacactctggtggttggatgagaacacgggtgtatttgagtcattcaatttttatatatttgaaatatagatatataaaacagttccttctcttacagctgcgttaccttggaaaacaccctcgtttagcagcgacagattccaaggggcagaaaagcaggtagctagggaaaaaaagttacagagtctagaatctaccttatttaaatgaacttgttacatttattttgctgaataacatgaaccgcttttttttgtctcaaaaattatattctaaataaaaaactttgagaatcca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]