LOCUS       NM_131637               1950 bp    mRNA    linear   VRT 09-OCT-2020
DEFINITION  Danio rerio claudin 7b (cldn7b), mRNA.
ACCESSION   NM_131637
VERSION     NM_131637.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1950)
  AUTHORS   Jin M, Wang D, Xu W, Wang H and Cao Y.
  TITLE     Claudin-7b and Claudin-h are required for controlling cilia
            morphogenesis in the zebrafish kidney
  JOURNAL   Mech Dev 161, 103595 (2020)
   PUBMED   31887432
REFERENCE   2  (bases 1 to 1950)
  AUTHORS   Zhang Z, Ran C, Ding QW, Liu HL, Xie MX, Yang YL, Xie YD, Gao CC,
            Zhang HL and Zhou ZG.
  TITLE     Ability of prebiotic polysaccharides to activate a
            HIF1alpha-antimicrobial peptide axis determines liver injury risk
            in zebrafish
  JOURNAL   Commun Biol 2, 274 (2019)
   PUBMED   31372513
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1950)
  AUTHORS   Lin X, Zhou Q, Zhao C, Lin G, Xu J and Wen Z.
  TITLE     An Ectoderm-Derived Myeloid-like Cell Population Functions as
            Antigen Transporters for Langerhans Cells in Zebrafish Epidermis
  JOURNAL   Dev Cell 49 (4), 605-617 (2019)
   PUBMED   31006648
REFERENCE   4  (bases 1 to 1950)
  AUTHORS   Beaudoin JD, Novoa EM, Vejnar CE, Yartseva V, Takacs CM, Kellis M
            and Giraldez AJ.
  TITLE     Analyses of mRNA structure dynamics identify embryonic gene
            regulatory programs
  JOURNAL   Nat Struct Mol Biol 25 (8), 677-686 (2018)
   PUBMED   30061596
REFERENCE   5  (bases 1 to 1950)
  AUTHORS   Li X, Song G, Zhao Y, Zhao F, Liu C, Liu D, Li Q and Cui Z.
  TITLE     Claudin7b is required for the formation and function of inner ear
            in zebrafish
  JOURNAL   J Cell Physiol 233 (4), 3195-3206 (2018)
   PUBMED   28834538
  REMARK    GeneRIF: Cldn7b is essential for the formation and proper function
            of inner ear
REFERENCE   6  (bases 1 to 1950)
  AUTHORS   Gallardo VE, Liang J, Behra M, Elkahloun A, Villablanca EJ, Russo
            V, Allende ML and Burgess SM.
  TITLE     Molecular dissection of the migrating posterior lateral line
            primordium during early development in zebrafish
  JOURNAL   BMC Dev Biol 10, 120 (2010)
   PUBMED   21144052
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 1950)
  AUTHORS   Clelland ES and Kelly SP.
  TITLE     Tight junction proteins in zebrafish ovarian follicles: stage
            specific mRNA abundance and response to 17beta-estradiol, human
            chorionic gonadotropin, and maturation inducing hormone
  JOURNAL   Gen Comp Endocrinol 168 (3), 388-400 (2010)
   PUBMED   20553723
REFERENCE   8  (bases 1 to 1950)
  AUTHORS   Davey C, Tallafuss A and Washbourne P.
  TITLE     Differential expression of neuroligin genes in the nervous system
            of zebrafish
  JOURNAL   Dev Dyn 239 (2), 703-714 (2010)
   PUBMED   20063411
REFERENCE   9  (bases 1 to 1950)
  AUTHORS   Reischauer S, Levesque MP, Nusslein-Volhard C and Sonawane M.
  TITLE     Lgl2 executes its function as a tumor suppressor by regulating ErbB
            signaling in the zebrafish epidermis
  JOURNAL   PLoS Genet 5 (11), e1000720 (2009)
   PUBMED   19911055
REFERENCE   10 (bases 1 to 1950)
  AUTHORS   Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B.
  TITLE     Extensive expansion of the claudin gene family in the teleost fish,
            Fugu rubripes
  JOURNAL   Genome Res 14 (7), 1248-1257 (2004)
   PUBMED   15197168
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AJ011788.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ011788.1, BC066408.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168448, SAMEA4476729
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..1950
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="10"
                     /map="10"
     gene            1..1950
                     /gene="cldn7b"
                     /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08;
                     wu:fd19f08"
                     /note="claudin 7b"
                     /db_xref="GeneID:60635"
                     /db_xref="ZFIN:ZDB-GENE-001103-5"
     misc_feature    138..140
                     /gene="cldn7b"
                     /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08;
                     wu:fd19f08"
                     /note="upstream in-frame stop codon"
     CDS             156..803
                     /gene="cldn7b"
                     /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08;
                     wu:fd19f08"
                     /note="claudin-7; claudin-like protein ZF4A22"
                     /codon_start=1
                     /product="claudin-7-B"
                     /protein_id="NP_571712.1"
                     /db_xref="GeneID:60635"
                     /db_xref="ZFIN:ZDB-GENE-001103-5"
                     /translation="

MAHKGLQLLGFTLSLLGLIGLIIGTIMPQWKMSAYVGDNIITAIAMYQGLWMSCAYQSTGQQQCKVYDSVLQLDSALQATRALMVVAILLTVAGLGVASMGMKCTNCGGDDKVKKSRIAMTGGIILSVGALCSIVACGWFTSQIIRDFYNPFTPVNTKYEFGAAIFIAWAGAFLDIMGGGMLASSCSKGQSSPNYPKSSRPVKSSRPPSSSKEYV"

     misc_feature    165..701
                     /gene="cldn7b"
                     /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08;
                     wu:fd19f08"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; pfam00822"
                     /db_xref="CDD:250157"
     misc_feature    177..239
                     /gene="cldn7b"
                     /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08;
                     wu:fd19f08"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YH92.1);
                     transmembrane region"
     misc_feature    399..461
                     /gene="cldn7b"
                     /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08;
                     wu:fd19f08"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YH92.1);
                     transmembrane region"
     misc_feature    507..569
                     /gene="cldn7b"
                     /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08;
                     wu:fd19f08"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YH92.1);
                     transmembrane region"
     misc_feature    642..704
                     /gene="cldn7b"
                     /gene_synonym="cb388; claudin7; cld; cldn7; fd19f08;
                     wu:fd19f08"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9YH92.1);
                     transmembrane region"
ORIGIN      

ccacgcgtccggcttctccgatttttatttacattttaaacttattttattattttgaccaattcataatcggaaggctgctgaaagcgagcgatatttggacactaataagttatttgctaagcaggtttagtttttaaactcattctgagaagatggcacataaaggactgcaactcctagggtttactctatcgttgctagggttgattgggctcattattggcacaatcatgccccagtggaagatgtctgcttacgttggagataatataatcacagctattgcgatgtaccagggcctttggatgtcgtgcgcttaccagagcaccggccaacagcaatgcaaggtgtatgactccgtcctacaactcgacagtgctctccaggcaactcgtgcccttatggttgtagcaattcttcttacagtagctggactgggtgtggccagcatgggcatgaagtgtactaactgtggtggtgatgacaaggtcaaaaagtcccgcattgccatgacaggcggtataatcctctctgttggagccctctgtagcattgttgcctgtggctggtttacaagtcaaattatcagggatttctacaaccccttcacacctgtcaatacaaagtatgaatttggtgcagctattttcatcgcctgggctggtgcatttctcgatataatgggtggaggcatgttggcctcttcttgctcaaagggtcagtcatctcctaattaccctaagtcctccagacccgtcaagtcctccagaccacccagcagcagcaaggaatatgtttgagccatttgttcacgagctggaaaggacatgatcaatcccagagcatgggtagaagtttgccctgtcagctgatatgagatctgtttaatttggtttgtatgtttgactatagatagaaaaaacagctcagaaaggtatttttggccaacttttacttgtgttctgatacagcagcccaccaaaaatggtcacttctttcttttggttagctccttgttccaccttccccaccccgattataaaatgtgagtttgcaaaggggcttcttccccagagtcttcctcatttcagattactgtcacctttagtgaacatgaaagagggagacctgctcagggaaaaatcattactcatactgctctgttacaccaaatctctgcttccagctgttaaacccttgcttgcatcattttaggaactgcgccagacactgaggtgcttatgaacaattaatacatgcattacatttttaaagctaagagtaacatgcaaataacctggttcactttgcagtcttttccctgtctggtccccatgccagcagaaactcttttcatacttcattttatacaaattagcaccctttaggtgaagtttcactcgtaagttcaatgaatcattcttttcagtgtatgctgatgaagctggattaaaacttttgatggaaaaatgaagattaatttggtttggatgaggcttaacatgaagcactaaaatcaaattgctctttcttatgcaacatgaaccttttgatttgctgttgtcctttgttttgagtgtacaccttggtttttgtgcccatttaggaaggtaacatgttttttgtttttatacactccattaattggtcacaaaaaagctgtgaatattggcttagttgaatcactgctggttccaactatttttatgttactgtaaaactttttttttttatccataatatgaacatttaaaactggactatacttttttttttttttgctttggtctgtgcttgaaccatttgatgtgggttgcactcaagtctacttaggatagagtcacgtgaatgtctgtgactagcttatgcaaatatttaactttttaaaatgtttttgacttcaagtttgcaattgaaaaattttatgtaaataaattttttaaacag

//