LOCUS       NM_120690                699 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana LOB domain-containing protein 33 (LBD33),
            mRNA.
ACCESSION   NM_120690
VERSION     NM_120690.5
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 699)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 699)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 699)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 699)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
            
            On Sep 12, 2016 this sequence version replaced NM_120690.4.
FEATURES             Location/Qualifiers
     source          1..699
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..699
                     /gene="LBD33"
                     /locus_tag="AT5G06080"
                     /gene_synonym="K16F4.4; K16F4_4; LOB domain-containing
                     protein 33"
                     /db_xref="Araport:AT5G06080"
                     /db_xref="GeneID:830495"
                     /db_xref="TAIR:AT5G06080"
     CDS             41..574
                     /gene="LBD33"
                     /locus_tag="AT5G06080"
                     /gene_synonym="K16F4.4; K16F4_4; LOB domain-containing
                     protein 33"
                     /inference="similar to RNA sequence, mRNA:INSD:AB473857.1"
                     /note="LOB domain-containing protein 33 (LBD33); CONTAINS
                     InterPro DOMAIN/s: Lateral organ boundaries, LOB
                     (InterPro:IPR004883); BEST Arabidopsis thaliana protein
                     match is: lateral organ boundaries-domain 29
                     (TAIR:AT3G58190.1); Has 1807 Blast hits to 1807 proteins
                     in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736;
                     Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes -
                     339 (source: NCBI BLink)."
                     /codon_start=1
                     /product="LOB domain-containing protein 33"
                     /protein_id="NP_196226.1"
                     /db_xref="GeneID:830495"
                     /db_xref="TAIR:AT5G06080"
                     /db_xref="Araport:AT5G06080"
                     /translation="

MASHGSSCGACKFLRRKCNRDCVFSPYFSYEQASSHFAAVHKVFGASNVSKHLLHLPQHQRNIAAITISYEALSRMRDPVYGCVAHIFALHQQVVTLQEEIEFLGSQMKNFSYSNQNGSQLNNIPEFVNQMTMATTNFVDESVLNNADGRNCYDGFFTNSEEMLVNHQWLQNMDYYY"

     misc_feature    59..358
                     /gene="LBD33"
                     /locus_tag="AT5G06080"
                     /gene_synonym="K16F4.4; K16F4_4; LOB domain-containing
                     protein 33"
                     /note="Lateral organ boundaries (LOB) domain; Region: LOB;
                     pfam03195"
                     /db_xref="CDD:460843"
ORIGIN      

aaaaggtaaaaacataaaacaaaacagagtaaaagaaaaaatggcaagtcatggatcatcttgtggagcatgcaagtttctaaggaggaaatgcaaccgcgactgcgtcttctcgccttacttcagctacgaacaagcctcttcccatttcgcagcggttcacaaagtcttcggcgcaagtaatgtctctaaacatttgcttcatttgcctcaacatcaaagaaacatcgctgctatcaccatctcctacgaggctctctctcgcatgcgtgatcctgtttatggctgcgttgctcacatcttcgctcttcatcaacaggttgtgactttgcaagaagagattgagtttctcgggtcacagatgaagaatttttcatactctaatcaaaacggatcacaacttaacaacataccggagtttgtgaatcagatgactatggccacgaccaatttcgtcgacgagagtgttttgaacaatgccgacggaagaaactgctatgatgggttcttcacgaactcagaggaaatgctcgtgaatcatcaatggctccagaacatggattattattactaagcacaacaaaattcgacgcgaactaaaaacgatggatctatatataatagttgtggagcatggttttgttgttatgataaatctgatttatgttttgtatatcagtcttgttatttacattcgcg

//