ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-26 01:34:53, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_053602 571 bp mRNA linear ROD 05-MAY-2025
DEFINITION Rattus norvegicus ATP synthase peripheral stalk subunit F6
(Atp5pf), transcript variant 1, mRNA; nuclear gene for
mitochondrial product.
ACCESSION NM_053602
VERSION NM_053602.2
KEYWORDS RefSeq; RefSeq Select.
SOURCE Rattus norvegicus (Norway rat)
ORGANISM Rattus norvegicus
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
REFERENCE 1 (bases 1 to 571)
AUTHORS Zhu,C., Zhang,W., Liu,J., Mu,B., Zhang,F., Lai,N., Zhou,J., Xu,A.
and Li,Y.
TITLE Marine collagen peptides reduce endothelial cell injury in diabetic
rats by inhibiting apoptosis and the expression of coupling factor
6 and microparticles
JOURNAL Mol Med Rep 16 (4), 3947-3957 (2017)
PUBMED 28731155
REFERENCE 2 (bases 1 to 571)
AUTHORS Li,N., Yin,J., Cai,W., Liu,J., Zhang,N., Yan,S., Song,L. and Li,X.
TITLE Coupling Factor 6 Is Upregulated in Monocrotaline-induced Pulmonary
Arterial Hypertension in Rats
JOURNAL Am J Med Sci 352 (6), 631-636 (2016)
PUBMED 27916219
REMARK GeneRIF: plasma level increased markedly during pathogenesis of
pulmonary arterial hypertension (PAH), indicating that CF6 may be
involved in the development of PAH
REFERENCE 3 (bases 1 to 571)
AUTHORS Yin,J., You,S., Li,N., Jiao,S., Hu,H., Xue,M., Wang,Y., Cheng,W.,
Liu,J., Xu,M., Yan,S. and Li,X.
TITLE Lung-specific RNA interference of coupling factor 6, a novel
peptide, attenuates pulmonary arterial hypertension in rats
JOURNAL Respir Res 17 (1), 99 (2016)
PUBMED 27491388
REMARK GeneRIF: CF6 shRNA effectively inhibited CF6 expression, abolished
lung macrophage infiltration, reversed endothelial dysfunction and
vascular remodeling, and ameliorated the severity of pulmonary
hypertension and right ventricular dysfunction at 4 weeks both as a
pretreatment and rescue intervention
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 571)
AUTHORS He,T., Guan,A., Shi,Y., Ge,Z. and Dai,H.
TITLE Mitochondrial coupling factor 6 upregulation in
hypertension-induced cardiac hypertrophy
JOURNAL Herz 40 (5), 783-787 (2015)
PUBMED 25900768
REMARK GeneRIF: CF6 protein was upregulated in cardiac hypertrophy induced
by hypertension; further mechanisms involved in this process should
be investigated.
REFERENCE 5 (bases 1 to 571)
AUTHORS Ramm,S., Morissey,B., Hernandez,B., Rooney,C., Pennington,S.R. and
Mally,A.
TITLE Application of a discovery to targeted LC-MS proteomics approach to
identify deregulated proteins associated with idiosyncratic liver
toxicity in a rat model of LPS/diclofenac co-administration
JOURNAL Toxicology 331, 100-111 (2015)
PUBMED 25772430
REFERENCE 6 (bases 1 to 571)
AUTHORS Osanai,T., Kamada,T., Fujiwara,N., Katoh,T., Takahashi,K.,
Kimura,M., Satoh,K., Magota,K., Kodama,S., Tanaka,T. and Okumura,K.
TITLE A novel inhibitory effect on prostacyclin synthesis of coupling
factor 6 extracted from the heart of spontaneously hypertensive
rats
JOURNAL J Biol Chem 273 (48), 31778-31783 (1998)
PUBMED 9822642
REFERENCE 7 (bases 1 to 571)
AUTHORS Higuti,T., Yoshihara,Y., Kuroiwa,K., Kawamura,Y., Toda,H. and
Sakiyama,F.
TITLE A simple, rapid method for purification of epsilon-subunit,
coupling factor 6, subunit d, and subunit e from rat liver H(+)-ATP
synthase and determination of the complete amino acid sequence of
epsilon-subunit
JOURNAL J Biol Chem 267 (31), 22658-22661 (1992)
PUBMED 1429613
REFERENCE 8 (bases 1 to 571)
AUTHORS Tracer,H.L., Loh,Y.P. and Birch,N.P.
TITLE Rat mitochondrial coupling factor 6: molecular cloning of a cDNA
encoding the imported precursor
JOURNAL Gene 116 (2), 291-292 (1992)
PUBMED 1386054
REFERENCE 9 (bases 1 to 571)
AUTHORS Yoshihara,Y., Nagase,H., Yamane,T., Oka,H., Tani,I. and Higuti,T.
TITLE H(+)-ATP synthase from rat liver mitochondria. A simple, rapid
purification method of the functional complex and its
characterization
JOURNAL Biochemistry 30 (28), 6854-6860 (1991)
PUBMED 1829963
REFERENCE 10 (bases 1 to 571)
AUTHORS Higuti,T., Osaka,F., Yoshihara,Y., Tsurumi,C., Kawamura,Y.,
Tani,I., Toda,H., Kakuno,T., Sakiyama,F., Tanaka,K. et al.
TITLE cDNA cloning and sequencing for the import precursor of coupling
factor 6 in H(+)-ATP synthase from rat liver mitochondria
JOURNAL Biochem Biophys Res Commun 171 (3), 1079-1086 (1990)
PUBMED 2145831
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
X54510.1.
On Feb 21, 2013 this sequence version replaced NM_053602.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: X54510.1, BG666039.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
SAMEA5756307, SAMEA5760383
[ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: inferred from homology
RefSeq Select criteria :: based on conservation,
expression, longest protein
##RefSeq-Attributes-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-571 X54510.1 1-571
FEATURES Location/Qualifiers
source 1..571
/organism="Rattus norvegicus"
/mol_type="mRNA"
/db_xref="taxon:10116"
/chromosome="11"
/map="11q11"
gene 1..571
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="ATP synthase peripheral stalk subunit F6"
/db_xref="GeneID:94271"
/db_xref="RGD:621376"
exon 1..145
/gene="Atp5pf"
/gene_synonym="Atp5j"
/inference="alignment:Splign:2.1.0"
misc_feature 96..98
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="upstream in-frame stop codon"
exon 146..325
/gene="Atp5pf"
/gene_synonym="Atp5j"
/inference="alignment:Splign:2.1.0"
CDS 162..488
/gene="Atp5pf"
/gene_synonym="Atp5j"
/EC_number="3.6.1.14"
/note="ATP synthase-coupling factor 6, mitochondrial;
ATPase subunit F6; ATP synthase, H+ transporting,
mitochondrial F0 complex, subunit F6; ATP synthase, H+
transporting, mitochondrial Fo complex, subunit F6"
/codon_start=1
/product="ATP synthase peripheral stalk subunit F6,
mitochondrial"
/protein_id="NP_446054.1"
/db_xref="GeneID:94271"
/db_xref="RGD:621376"
/translation="
MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTGPEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS"
misc_feature 162..449
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="Mitochondrial ATP synthase coupling factor 6;
Region: ATP-synt_F6; pfam05511"
/db_xref="CDD:461669"
transit_peptide 162..257
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="Mitochondrion.
/evidence=ECO:0000269|PubMed:1429613; propagated from
UniProtKB/Swiss-Prot (P21571.1)"
mat_peptide 258..485
/gene="Atp5pf"
/gene_synonym="Atp5j"
/product="ATP synthase peripheral stalk subunit F6,
mitochondrial"
misc_feature 282..284
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P18859; propagated from
UniProtKB/Swiss-Prot (P21571.1); acetylation site"
misc_feature 297..299
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P18859; propagated from
UniProtKB/Swiss-Prot (P21571.1); acetylation site"
misc_feature 396..398
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P97450; propagated from
UniProtKB/Swiss-Prot (P21571.1); acetylation site"
misc_feature 411..413
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0000250|UniProtKB:P97450; propagated from
UniProtKB/Swiss-Prot (P21571.1); acetylation site"
misc_feature 456..458
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="N6-acetyllysine, alternate.
/evidence=ECO:0000250|UniProtKB:P18859; propagated from
UniProtKB/Swiss-Prot (P21571.1); acetylation site"
misc_feature 474..476
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="N6-acetyllysine.
/evidence=ECO:0000250|UniProtKB:P18859; propagated from
UniProtKB/Swiss-Prot (P21571.1); acetylation site"
misc_feature 483..485
/gene="Atp5pf"
/gene_synonym="Atp5j"
/note="Phosphoserine.
/evidence=ECO:0007744|PubMed:22673903; propagated from
UniProtKB/Swiss-Prot (P21571.1); phosphorylation site"
exon 326..450
/gene="Atp5pf"
/gene_synonym="Atp5j"
/inference="alignment:Splign:2.1.0"
exon 451..571
/gene="Atp5pf"
/gene_synonym="Atp5j"
/inference="alignment:Splign:2.1.0"
ORIGIN
gcttcctgtccggtgagcgtcgaacgactgaagcggtggcccatagtgcattgcgatggcgggtaggcgtgtgtaggcggagccagggccggaagtagaacggtggcggcggcggtgactctggcagctcgggactcagtgcaagtaccacagactcaaccatgactgttcagaggatcttcaggctctcctctgtccttcggtcagcagtctctgtgcatttgaggaggaacattggtgttacagctgtggcgtttaataaggaacttgatcctgtacagaaactcttcttggacaagataagagagtacaaagcaaagcgactggcgtctggaggacctgttgatactggcccagaatatcagcaagaggtggacagagagctttttaagcttaaacaaatgtatggtaaaggagagatggataagtttcctaccttcaattttgaggatcccaaatttgaagtcctcgacaaaccccagtcctgaggaacatacaaaccatgtggtaatttgtcatgacttagttgtacaattaatctaaaaaattcaaataaacattcacttcacag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]