GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 09:47:23, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_053602                571 bp    mRNA    linear   ROD 05-MAY-2025
DEFINITION  Rattus norvegicus ATP synthase peripheral stalk subunit F6
            (Atp5pf), transcript variant 1, mRNA; nuclear gene for
            mitochondrial product.
ACCESSION   NM_053602
VERSION     NM_053602.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 571)
  AUTHORS   Zhu,C., Zhang,W., Liu,J., Mu,B., Zhang,F., Lai,N., Zhou,J., Xu,A.
            and Li,Y.
  TITLE     Marine collagen peptides reduce endothelial cell injury in diabetic
            rats by inhibiting apoptosis and the expression of coupling factor
            6 and microparticles
  JOURNAL   Mol Med Rep 16 (4), 3947-3957 (2017)
   PUBMED   28731155
REFERENCE   2  (bases 1 to 571)
  AUTHORS   Li,N., Yin,J., Cai,W., Liu,J., Zhang,N., Yan,S., Song,L. and Li,X.
  TITLE     Coupling Factor 6 Is Upregulated in Monocrotaline-induced Pulmonary
            Arterial Hypertension in Rats
  JOURNAL   Am J Med Sci 352 (6), 631-636 (2016)
   PUBMED   27916219
  REMARK    GeneRIF: plasma level increased markedly during pathogenesis of
            pulmonary arterial hypertension (PAH), indicating that CF6 may be
            involved in the development of PAH
REFERENCE   3  (bases 1 to 571)
  AUTHORS   Yin,J., You,S., Li,N., Jiao,S., Hu,H., Xue,M., Wang,Y., Cheng,W.,
            Liu,J., Xu,M., Yan,S. and Li,X.
  TITLE     Lung-specific RNA interference of coupling factor 6, a novel
            peptide, attenuates pulmonary arterial hypertension in rats
  JOURNAL   Respir Res 17 (1), 99 (2016)
   PUBMED   27491388
  REMARK    GeneRIF: CF6 shRNA effectively inhibited CF6 expression, abolished
            lung macrophage infiltration, reversed endothelial dysfunction and
            vascular remodeling, and ameliorated the severity of pulmonary
            hypertension and right ventricular dysfunction at 4 weeks both as a
            pretreatment and rescue intervention
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 571)
  AUTHORS   He,T., Guan,A., Shi,Y., Ge,Z. and Dai,H.
  TITLE     Mitochondrial coupling factor 6 upregulation in
            hypertension-induced cardiac hypertrophy
  JOURNAL   Herz 40 (5), 783-787 (2015)
   PUBMED   25900768
  REMARK    GeneRIF: CF6 protein was upregulated in cardiac hypertrophy induced
            by hypertension; further mechanisms involved in this process should
            be investigated.
REFERENCE   5  (bases 1 to 571)
  AUTHORS   Ramm,S., Morissey,B., Hernandez,B., Rooney,C., Pennington,S.R. and
            Mally,A.
  TITLE     Application of a discovery to targeted LC-MS proteomics approach to
            identify deregulated proteins associated with idiosyncratic liver
            toxicity in a rat model of LPS/diclofenac co-administration
  JOURNAL   Toxicology 331, 100-111 (2015)
   PUBMED   25772430
REFERENCE   6  (bases 1 to 571)
  AUTHORS   Osanai,T., Kamada,T., Fujiwara,N., Katoh,T., Takahashi,K.,
            Kimura,M., Satoh,K., Magota,K., Kodama,S., Tanaka,T. and Okumura,K.
  TITLE     A novel inhibitory effect on prostacyclin synthesis of coupling
            factor 6 extracted from the heart of spontaneously hypertensive
            rats
  JOURNAL   J Biol Chem 273 (48), 31778-31783 (1998)
   PUBMED   9822642
REFERENCE   7  (bases 1 to 571)
  AUTHORS   Higuti,T., Yoshihara,Y., Kuroiwa,K., Kawamura,Y., Toda,H. and
            Sakiyama,F.
  TITLE     A simple, rapid method for purification of epsilon-subunit,
            coupling factor 6, subunit d, and subunit e from rat liver H(+)-ATP
            synthase and determination of the complete amino acid sequence of
            epsilon-subunit
  JOURNAL   J Biol Chem 267 (31), 22658-22661 (1992)
   PUBMED   1429613
REFERENCE   8  (bases 1 to 571)
  AUTHORS   Tracer,H.L., Loh,Y.P. and Birch,N.P.
  TITLE     Rat mitochondrial coupling factor 6: molecular cloning of a cDNA
            encoding the imported precursor
  JOURNAL   Gene 116 (2), 291-292 (1992)
   PUBMED   1386054
REFERENCE   9  (bases 1 to 571)
  AUTHORS   Yoshihara,Y., Nagase,H., Yamane,T., Oka,H., Tani,I. and Higuti,T.
  TITLE     H(+)-ATP synthase from rat liver mitochondria. A simple, rapid
            purification method of the functional complex and its
            characterization
  JOURNAL   Biochemistry 30 (28), 6854-6860 (1991)
   PUBMED   1829963
REFERENCE   10 (bases 1 to 571)
  AUTHORS   Higuti,T., Osaka,F., Yoshihara,Y., Tsurumi,C., Kawamura,Y.,
            Tani,I., Toda,H., Kakuno,T., Sakiyama,F., Tanaka,K. et al.
  TITLE     cDNA cloning and sequencing for the import precursor of coupling
            factor 6 in H(+)-ATP synthase from rat liver mitochondria
  JOURNAL   Biochem Biophys Res Commun 171 (3), 1079-1086 (1990)
   PUBMED   2145831
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            X54510.1.
            
            On Feb 21, 2013 this sequence version replaced NM_053602.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: X54510.1, BG666039.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5756307, SAMEA5760383
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: inferred from homology
            RefSeq Select criteria             :: based on conservation,
                                                  expression, longest protein
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-571               X54510.1           1-571
FEATURES             Location/Qualifiers
     source          1..571
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="11"
                     /map="11q11"
     gene            1..571
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="ATP synthase peripheral stalk subunit F6"
                     /db_xref="GeneID:94271"
                     /db_xref="RGD:621376"
     exon            1..145
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    96..98
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="upstream in-frame stop codon"
     exon            146..325
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /inference="alignment:Splign:2.1.0"
     CDS             162..488
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /EC_number="3.6.1.14"
                     /note="ATP synthase-coupling factor 6, mitochondrial;
                     ATPase subunit F6; ATP synthase, H+ transporting,
                     mitochondrial F0 complex, subunit F6; ATP synthase, H+
                     transporting, mitochondrial Fo complex, subunit F6"
                     /codon_start=1
                     /product="ATP synthase peripheral stalk subunit F6,
                     mitochondrial"
                     /protein_id="NP_446054.1"
                     /db_xref="GeneID:94271"
                     /db_xref="RGD:621376"
                     /translation="
MTVQRIFRLSSVLRSAVSVHLRRNIGVTAVAFNKELDPVQKLFLDKIREYKAKRLASGGPVDTGPEYQQEVDRELFKLKQMYGKGEMDKFPTFNFEDPKFEVLDKPQS"
     misc_feature    162..449
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="Mitochondrial ATP synthase coupling factor 6;
                     Region: ATP-synt_F6; pfam05511"
                     /db_xref="CDD:461669"
     transit_peptide 162..257
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="Mitochondrion.
                     /evidence=ECO:0000269|PubMed:1429613; propagated from
                     UniProtKB/Swiss-Prot (P21571.1)"
     mat_peptide     258..485
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /product="ATP synthase peripheral stalk subunit F6,
                     mitochondrial"
     misc_feature    282..284
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P18859; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    297..299
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P18859; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    396..398
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P97450; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    411..413
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P97450; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    456..458
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine, alternate.
                     /evidence=ECO:0000250|UniProtKB:P18859; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    474..476
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="N6-acetyllysine.
                     /evidence=ECO:0000250|UniProtKB:P18859; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); acetylation site"
     misc_feature    483..485
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (P21571.1); phosphorylation site"
     exon            326..450
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /inference="alignment:Splign:2.1.0"
     exon            451..571
                     /gene="Atp5pf"
                     /gene_synonym="Atp5j"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gcttcctgtccggtgagcgtcgaacgactgaagcggtggcccatagtgcattgcgatggcgggtaggcgtgtgtaggcggagccagggccggaagtagaacggtggcggcggcggtgactctggcagctcgggactcagtgcaagtaccacagactcaaccatgactgttcagaggatcttcaggctctcctctgtccttcggtcagcagtctctgtgcatttgaggaggaacattggtgttacagctgtggcgtttaataaggaacttgatcctgtacagaaactcttcttggacaagataagagagtacaaagcaaagcgactggcgtctggaggacctgttgatactggcccagaatatcagcaagaggtggacagagagctttttaagcttaaacaaatgtatggtaaaggagagatggataagtttcctaccttcaattttgaggatcccaaatttgaagtcctcgacaaaccccagtcctgaggaacatacaaaccatgtggtaatttgtcatgacttagttgtacaattaatctaaaaaattcaaataaacattcacttcacag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]