2025-07-10 17:22:07, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_053324 1506 bp mRNA linear ROD 03-APR-2024 DEFINITION Rattus norvegicus synaptotagmin 9 (Syt9), mRNA. ACCESSION NM_053324 VERSION NM_053324.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1506) AUTHORS Gautam,V., D'Avanzo,C., Berezovska,O., Tanzi,R.E. and Kovacs,D.M. TITLE Synaptotagmins interact with APP and promote Abeta generation JOURNAL Mol Neurodegener 10, 31 (2015) PUBMED 26202512 REMARK GeneRIF: Syt-9 regulates endogenous APP-CTF and Abeta levels in PC12 cells. Publication Status: Online-Only REFERENCE 2 (bases 1 to 1506) AUTHORS Zhang,Z., Wu,Y., Wang,Z., Dunning,F.M., Rehfuss,J., Ramanan,D., Chapman,E.R. and Jackson,M.B. TITLE Release mode of large and small dense-core vesicles specified by different synaptotagmin isoforms in PC12 cells JOURNAL Mol Biol Cell 22 (13), 2324-2336 (2011) PUBMED 21551071 REFERENCE 3 (bases 1 to 1506) AUTHORS Matsuoka,H., Harada,K., Nakamura,J., Fukuda,M. and Inoue,M. TITLE Differential distribution of synaptotagmin-1, -4, -7, and -9 in rat adrenal chromaffin cells JOURNAL Cell Tissue Res 344 (1), 41-50 (2011) PUBMED 21287204 REMARK GeneRIF: In contrast to PC12 cells and the pancreatic beta cell line INS-1, Syt9 was not immunodetected in large dense-core vesicles in rat chromaffin cells. REFERENCE 4 (bases 1 to 1506) AUTHORS Zhang,Z., Hui,E., Chapman,E.R. and Jackson,M.B. TITLE Regulation of exocytosis and fusion pores by synaptotagmin-effector interactions JOURNAL Mol Biol Cell 21 (16), 2821-2831 (2010) PUBMED 20573977 REMARK GeneRIF: Data show that Syt I produced more rapid dilation of fusion pores than syt VII or syt IX, consistent with its role in synchronous synaptic release. REFERENCE 5 (bases 1 to 1506) AUTHORS Gauthier,B.R. and Wollheim,C.B. TITLE Synaptotagmins bind calcium to release insulin JOURNAL Am J Physiol Endocrinol Metab 295 (6), E1279-E1286 (2008) PUBMED 18713958 REMARK Review article REFERENCE 6 (bases 1 to 1506) AUTHORS Fukuda,M. TITLE RNA interference-mediated silencing of synaptotagmin IX, but not synaptotagmin I, inhibits dense-core vesicle exocytosis in PC12 cells JOURNAL Biochem J 380 (Pt 3), 875-879 (2004) PUBMED 15015935 REFERENCE 7 (bases 1 to 1506) AUTHORS Tucker,W.C., Edwardson,J.M., Bai,J., Kim,H.J., Martin,T.F. and Chapman,E.R. TITLE Identification of synaptotagmin effectors via acute inhibition of secretion from cracked PC12 cells JOURNAL J Cell Biol 162 (2), 199-209 (2003) PUBMED 12860971 REFERENCE 8 (bases 1 to 1506) AUTHORS Fukuda,M., Kowalchyk,J.A., Zhang,X., Martin,T.F. and Mikoshiba,K. TITLE Synaptotagmin IX regulates Ca2+-dependent secretion in PC12 cells JOURNAL J Biol Chem 277 (7), 4601-4604 (2002) PUBMED 11751925 REFERENCE 9 (bases 1 to 1506) AUTHORS Fukuda,M., Kanno,E. and Mikoshiba,K. TITLE Conserved N-terminal cysteine motif is essential for homo- and heterodimer formation of synaptotagmins III, V, VI, and X JOURNAL J Biol Chem 274 (44), 31421-31427 (1999) PUBMED 10531343 REFERENCE 10 (bases 1 to 1506) AUTHORS Li,C., Ullrich,B., Zhang,J.Z., Anderson,R.G., Brose,N. and Sudhof,T.C. TITLE Ca(2+)-dependent and -independent activities of neural and non-neural synaptotagmins JOURNAL Nature 375 (6532), 594-599 (1995) PUBMED 7791877 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF375461.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF375461.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMD00132261, SAMD00132262 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1506 /organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="1" /map="1q33" gene 1..1506 /gene="Syt9" /gene_synonym="Sytv" /note="synaptotagmin 9" /db_xref="GeneID:60564" /db_xref="RGD:621169" CDS 1..1476 /gene="Syt9" /gene_synonym="Sytv" /note="sytIX; synaptotagmin 5; synaptotagmin V; synaptogamin V; synaptotagmin IX" /codon_start=1 /product="synaptotagmin-9" /protein_id="NP_445776.1" /db_xref="GeneID:60564" /db_xref="RGD:621169" /translation="
MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQDNCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLLEKR"
misc_feature 25..93 /gene="Syt9" /gene_synonym="Sytv" /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1); Region: Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681" misc_feature 157..219 /gene="Syt9" /gene_synonym="Sytv" /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1); transmembrane region" misc_feature 271..441 /gene="Syt9" /gene_synonym="Sytv" /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 529..531 /gene="Syt9" /gene_synonym="Sytv" /note="Phosphoserine. /evidence=ECO:0007744|PubMed:22673903; propagated from UniProtKB/Swiss-Prot (Q925C0.1); phosphorylation site" misc_feature 661..1035 /gene="Syt9" /gene_synonym="Sytv" /note="C2 domain; Region: C2; cl14603" /db_xref="CDD:472691" misc_feature 1060..1461 /gene="Syt9" /gene_synonym="Sytv" /note="C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10; Region: C2B_Synaptotagmin-3-5-6-9-10; cd08403" /db_xref="CDD:176048" misc_feature order(1147..1149,1165..1167,1237..1239,1327..1329, 1333..1335,1351..1353) /gene="Syt9" /gene_synonym="Sytv" /note="Ca2+ binding site [ion binding]; other site" /db_xref="CDD:176048" exon 1..145 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 146..497 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 498..1044 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 1045..1165 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 1166..1337 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 1338..1467 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" exon 1468..1506 /gene="Syt9" /gene_synonym="Sytv" /inference="alignment:Splign:2.1.0" ORIGIN
atgcccggggccagggacgcgctctgtcaccaggcgctgcagctgctggccgagctctgtgcccgaggggccctggagcacgacagctgccaagatttcatctaccacctgcgggaccgtgccagaccccggctccgcgacccagatatctctgtgagcctgctaactctcgtggttaccgcctgtggtcttgccctctttggtgtctctcttttcgtgtcttggaaactgtgctgggttccgtggcgagagcgaggcctgttctctggtagcaaagacaacaaccaagagcctcttaactacactgatacagagacaaatgagcaggagaacagcgaggacttcctagacccacccacaccctgcccggactcctccatgaagatcagccacacttcccccgacattcccctctccacccagccaggtggccaggacaactgtgcccatgccgtccgtgtacagcgacaagtcacagagccaacgccgtcagctcggcataactcaatccgaagacaactcaacctgtcaaacccggactttaatatccaacagcttcagaggcaggagcagttgactgggattggtagaattaagccagagttatataaacagaggtcactggacaacgacgatgggaggagaagtaacagcaaagcctgcgggaaactgaacttcatcttaaaatacgactgcgacttggaacagctcatcgtgaagatccacaaagccgtcaatctgcccgccaaggacttctctgggacgtcagatccttatgtcaagatctacttgcttcctgaccggaaaacaaaacaccagactaaggttcacaggaagaccctgaaccctgtgtttgacgaggtgtttttatttcctgtgcactacaatgaccttgaagctcggaagcttcacttctccgtgtatgactttgacaggttctctcgccatgacttgattggtcaagtggtggtggaccacttcttcgacttggctgacttccccagggagtgcatcctttggaaggatatcgagtatgtcaccaacgataatgtggacctgggtgagcttatgttttcgctctgctatcttccaacagccggcaggctgaccatcaccatcatcaaagcaaggaatttaaaggcaatggacattacgggagcgtcagatccgtacgtgaaagtctcactgatgtgtgatggccggagactgaagaagaggaaaacatccaccaagaggaacacgcttaaccctgtttacaatgaagccatagtcttcgatgtccctcctgagagcattgatcagatccacttgtccatagctgtcatggactatgaccgtgtaggtcacaatgaggtcatcggcgtgtgccaagtaggcaacgaggctgagcggctgggcagagaccactggagtgagatgctgtcatatccccgaaagcccatcgcacactggcactctctgctggagaaacgatgattgtggataggaagactgcttttgccaagg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]