GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-19 08:42:03, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_053324               1506 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus synaptotagmin 9 (Syt9), mRNA.
ACCESSION   NM_053324
VERSION     NM_053324.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1506)
  AUTHORS   Gautam,V., D'Avanzo,C., Berezovska,O., Tanzi,R.E. and Kovacs,D.M.
  TITLE     Synaptotagmins interact with APP and promote Abeta generation
  JOURNAL   Mol Neurodegener 10, 31 (2015)
   PUBMED   26202512
  REMARK    GeneRIF: Syt-9 regulates endogenous APP-CTF and Abeta levels in
            PC12 cells.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1506)
  AUTHORS   Zhang,Z., Wu,Y., Wang,Z., Dunning,F.M., Rehfuss,J., Ramanan,D.,
            Chapman,E.R. and Jackson,M.B.
  TITLE     Release mode of large and small dense-core vesicles specified by
            different synaptotagmin isoforms in PC12 cells
  JOURNAL   Mol Biol Cell 22 (13), 2324-2336 (2011)
   PUBMED   21551071
REFERENCE   3  (bases 1 to 1506)
  AUTHORS   Matsuoka,H., Harada,K., Nakamura,J., Fukuda,M. and Inoue,M.
  TITLE     Differential distribution of synaptotagmin-1, -4, -7, and -9 in rat
            adrenal chromaffin cells
  JOURNAL   Cell Tissue Res 344 (1), 41-50 (2011)
   PUBMED   21287204
  REMARK    GeneRIF: In contrast to PC12 cells and the pancreatic beta cell
            line INS-1, Syt9 was not immunodetected in large dense-core
            vesicles in rat chromaffin cells.
REFERENCE   4  (bases 1 to 1506)
  AUTHORS   Zhang,Z., Hui,E., Chapman,E.R. and Jackson,M.B.
  TITLE     Regulation of exocytosis and fusion pores by synaptotagmin-effector
            interactions
  JOURNAL   Mol Biol Cell 21 (16), 2821-2831 (2010)
   PUBMED   20573977
  REMARK    GeneRIF: Data show that Syt I produced more rapid dilation of
            fusion pores than syt VII or syt IX, consistent with its role in
            synchronous synaptic release.
REFERENCE   5  (bases 1 to 1506)
  AUTHORS   Gauthier,B.R. and Wollheim,C.B.
  TITLE     Synaptotagmins bind calcium to release insulin
  JOURNAL   Am J Physiol Endocrinol Metab 295 (6), E1279-E1286 (2008)
   PUBMED   18713958
  REMARK    Review article
REFERENCE   6  (bases 1 to 1506)
  AUTHORS   Fukuda,M.
  TITLE     RNA interference-mediated silencing of synaptotagmin IX, but not
            synaptotagmin I, inhibits dense-core vesicle exocytosis in PC12
            cells
  JOURNAL   Biochem J 380 (Pt 3), 875-879 (2004)
   PUBMED   15015935
REFERENCE   7  (bases 1 to 1506)
  AUTHORS   Tucker,W.C., Edwardson,J.M., Bai,J., Kim,H.J., Martin,T.F. and
            Chapman,E.R.
  TITLE     Identification of synaptotagmin effectors via acute inhibition of
            secretion from cracked PC12 cells
  JOURNAL   J Cell Biol 162 (2), 199-209 (2003)
   PUBMED   12860971
REFERENCE   8  (bases 1 to 1506)
  AUTHORS   Fukuda,M., Kowalchyk,J.A., Zhang,X., Martin,T.F. and Mikoshiba,K.
  TITLE     Synaptotagmin IX regulates Ca2+-dependent secretion in PC12 cells
  JOURNAL   J Biol Chem 277 (7), 4601-4604 (2002)
   PUBMED   11751925
REFERENCE   9  (bases 1 to 1506)
  AUTHORS   Fukuda,M., Kanno,E. and Mikoshiba,K.
  TITLE     Conserved N-terminal cysteine motif is essential for homo- and
            heterodimer formation of synaptotagmins III, V, VI, and X
  JOURNAL   J Biol Chem 274 (44), 31421-31427 (1999)
   PUBMED   10531343
REFERENCE   10 (bases 1 to 1506)
  AUTHORS   Li,C., Ullrich,B., Zhang,J.Z., Anderson,R.G., Brose,N. and
            Sudhof,T.C.
  TITLE     Ca(2+)-dependent and -independent activities of neural and
            non-neural synaptotagmins
  JOURNAL   Nature 375 (6532), 594-599 (1995)
   PUBMED   7791877
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF375461.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF375461.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1506
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="1"
                     /map="1q33"
     gene            1..1506
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="synaptotagmin 9"
                     /db_xref="GeneID:60564"
                     /db_xref="RGD:621169"
     CDS             1..1476
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="sytIX; synaptotagmin 5; synaptotagmin V;
                     synaptogamin V; synaptotagmin IX"
                     /codon_start=1
                     /product="synaptotagmin-9"
                     /protein_id="NP_445776.1"
                     /db_xref="GeneID:60564"
                     /db_xref="RGD:621169"
                     /translation="
MPGARDALCHQALQLLAELCARGALEHDSCQDFIYHLRDRARPRLRDPDISVSLLTLVVTACGLALFGVSLFVSWKLCWVPWRERGLFSGSKDNNQEPLNYTDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQPGGQDNCAHAVRVQRQVTEPTPSARHNSIRRQLNLSNPDFNIQQLQRQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMDITGASDPYVKVSLMCDGRRLKKRKTSTKRNTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDRVGHNEVIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWHSLLEKR"
     misc_feature    25..93
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1);
                     Region: Cysteine motif.
                     /evidence=ECO:0000250|UniProtKB:O35681"
     misc_feature    157..219
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1);
                     transmembrane region"
     misc_feature    271..441
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="propagated from UniProtKB/Swiss-Prot (Q925C0.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    529..531
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="Phosphoserine.
                     /evidence=ECO:0007744|PubMed:22673903; propagated from
                     UniProtKB/Swiss-Prot (Q925C0.1); phosphorylation site"
     misc_feature    661..1035
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="C2 domain; Region: C2; cl14603"
                     /db_xref="CDD:472691"
     misc_feature    1060..1461
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="C2 domain second repeat present in Synaptotagmins
                     3, 5, 6, 9, and 10; Region: C2B_Synaptotagmin-3-5-6-9-10;
                     cd08403"
                     /db_xref="CDD:176048"
     misc_feature    order(1147..1149,1165..1167,1237..1239,1327..1329,
                     1333..1335,1351..1353)
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:176048"
     exon            1..145
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            146..497
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            498..1044
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            1045..1165
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            1166..1337
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            1338..1467
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
     exon            1468..1506
                     /gene="Syt9"
                     /gene_synonym="Sytv"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgcccggggccagggacgcgctctgtcaccaggcgctgcagctgctggccgagctctgtgcccgaggggccctggagcacgacagctgccaagatttcatctaccacctgcgggaccgtgccagaccccggctccgcgacccagatatctctgtgagcctgctaactctcgtggttaccgcctgtggtcttgccctctttggtgtctctcttttcgtgtcttggaaactgtgctgggttccgtggcgagagcgaggcctgttctctggtagcaaagacaacaaccaagagcctcttaactacactgatacagagacaaatgagcaggagaacagcgaggacttcctagacccacccacaccctgcccggactcctccatgaagatcagccacacttcccccgacattcccctctccacccagccaggtggccaggacaactgtgcccatgccgtccgtgtacagcgacaagtcacagagccaacgccgtcagctcggcataactcaatccgaagacaactcaacctgtcaaacccggactttaatatccaacagcttcagaggcaggagcagttgactgggattggtagaattaagccagagttatataaacagaggtcactggacaacgacgatgggaggagaagtaacagcaaagcctgcgggaaactgaacttcatcttaaaatacgactgcgacttggaacagctcatcgtgaagatccacaaagccgtcaatctgcccgccaaggacttctctgggacgtcagatccttatgtcaagatctacttgcttcctgaccggaaaacaaaacaccagactaaggttcacaggaagaccctgaaccctgtgtttgacgaggtgtttttatttcctgtgcactacaatgaccttgaagctcggaagcttcacttctccgtgtatgactttgacaggttctctcgccatgacttgattggtcaagtggtggtggaccacttcttcgacttggctgacttccccagggagtgcatcctttggaaggatatcgagtatgtcaccaacgataatgtggacctgggtgagcttatgttttcgctctgctatcttccaacagccggcaggctgaccatcaccatcatcaaagcaaggaatttaaaggcaatggacattacgggagcgtcagatccgtacgtgaaagtctcactgatgtgtgatggccggagactgaagaagaggaaaacatccaccaagaggaacacgcttaaccctgtttacaatgaagccatagtcttcgatgtccctcctgagagcattgatcagatccacttgtccatagctgtcatggactatgaccgtgtaggtcacaatgaggtcatcggcgtgtgccaagtaggcaacgaggctgagcggctgggcagagaccactggagtgagatgctgtcatatccccgaaagcccatcgcacactggcactctctgctggagaaacgatgattgtggataggaagactgcttttgccaagg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]