GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:22:56, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_033412               1171 bp    mRNA    linear   PRI 02-MAY-2019
DEFINITION  Homo sapiens solute carrier family 25 member 51 (SLC25A51),
            transcript variant 1, mRNA.
ACCESSION   NM_033412
VERSION     NM_033412.4
KEYWORDS    RefSeq; MANE Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1171)
  AUTHORS   Palmieri F.
  TITLE     The mitochondrial transporter family SLC25: identification,
            properties and physiopathology
  JOURNAL   Mol. Aspects Med. 34 (2-3), 465-484 (2013)
   PUBMED   23266187
  REMARK    GeneRIF: Compares and contrasts all the known human SLC25A* genes
            and includes functional information.
            Review article
REFERENCE   2  (bases 1 to 1171)
  AUTHORS   Hendrickson SL, Lautenberger JA, Chinn LW, Malasky M, Sezgin E,
            Kingsley LA, Goedert JJ, Kirk GD, Gomperts ED, Buchbinder SP,
            Troyer JL and O'Brien SJ.
  TITLE     Genetic variants in nuclear-encoded mitochondrial genes influence
            AIDS progression
  JOURNAL   PLoS ONE 5 (9), e12862 (2010)
   PUBMED   20877624
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
            Publication Status: Online-Only
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL138752.5 and BG953457.1.
            On Nov 22, 2018 this sequence version replaced NM_033412.3.
            
            Transcript Variant: This variant (1) represents the shortest
            transcript and encodes the functional protein.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR1163657.553178.1,
                                           SRR1803617.261653.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1966682
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            gene product(s) localized to mito. :: reported by MitoCarta
            MANE Ensembl match                 :: ENST00000242275.7/
                                                  ENSP00000242275.6
            RefSeq Select criteria             :: based on single
                                                  protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-60                AL138752.5         41062-41121
            61-182              AL138752.5         45239-45360
            183-1124            AL138752.5         56597-57538
            1125-1171           BG953457.1         312-358
FEATURES             Location/Qualifiers
     source          1..1171
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="9"
                     /map="9p13.2-p13.1"
     gene            1..1171
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /note="solute carrier family 25 member 51"
                     /db_xref="GeneID:92014"
                     /db_xref="HGNC:HGNC:23323"
     exon            1..60
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /inference="alignment:Splign:2.1.0"
     variation       2
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280629023"
     variation       4
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1319265456"
     variation       6
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553350924"
     variation       7
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1232749757"
     variation       8
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770468141"
     variation       19
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027618313"
     variation       20
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040661583"
     variation       22
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:995778284"
     variation       27
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429283651"
     variation       33
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:964329475"
     variation       34
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1018280815"
     variation       35
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1170331892"
     variation       38
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1415252549"
     variation       41
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184281038"
     variation       42
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:191795683"
     variation       43
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300510027"
     variation       44
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1052147237"
     variation       47
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1425068781"
     variation       48
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:532177372"
     variation       49
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:566419606"
     variation       50
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:999737792"
     variation       53
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:538695671"
     variation       54
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1043996750"
     variation       58
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:915884088"
     variation       60
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208593585"
     exon            61..182
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /inference="alignment:Splign:2.1.0"
     variation       65
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1429688565"
     variation       73
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:901172627"
     variation       74
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1372521737"
     variation       82
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1018257578"
     variation       85
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:900668791"
     variation       96
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1383986133"
     variation       105
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:113506726"
     variation       107
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1275238579"
     variation       110
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:904592323"
     variation       112
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1043165351"
     variation       113
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7034305"
     variation       114
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1412735425"
     variation       116
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:913512830"
     variation       117
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:891633923"
     variation       118
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:539307884"
     variation       122
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:577077776"
     variation       126
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:553873422"
     variation       127
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201385939"
     variation       137
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1378594571"
     variation       138
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1449351425"
     variation       141
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:926007011"
     variation       146
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:980160329"
     variation       148
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948872078"
     variation       150
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1461479421"
     variation       160
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:938619263"
     variation       162
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1430557981"
     variation       163
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1371252161"
     variation       168
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1171961590"
     variation       169
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776748446"
     variation       172
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1388776370"
     variation       173
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1256403664"
     exon            183..1171
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /inference="alignment:Splign:2.1.0"
     variation       186..192
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="aaa"
                     /replace="aaaaaaa"
                     /db_xref="dbSNP:1401238911"
     variation       194
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374759287"
     variation       195
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766955245"
     variation       198
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1202416854"
     misc_feature    201..203
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /note="upstream in-frame stop codon"
     variation       202
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763577819"
     variation       204
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750759374"
     variation       205..213
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="aaaga"
                     /replace="aaagaaaga"
                     /db_xref="dbSNP:1240455237"
     variation       209
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1182672535"
     variation       210
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765701036"
     variation       217
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776704099"
     variation       220
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201543549"
     variation       221
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371169995"
     CDS             225..1118
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /note="mitochondrial carrier triple repeat protein 1;
                     mitochondrial carrier triple repeat 1"
                     /codon_start=1
                     /product="solute carrier family 25 member 51"
                     /protein_id="NP_219480.1"
                     /db_xref="CCDS:CCDS6614.1"
                     /db_xref="GeneID:92014"
                     /db_xref="HGNC:HGNC:23323"
                     /translation="
MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI"
     misc_feature    306..548
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     Region: Solcar 1"
     misc_feature    315..560
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     cl28162"
                     /db_xref="CDD:332982"
     misc_feature    330..392
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     transmembrane region"
     misc_feature    477..539
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     transmembrane region"
     misc_feature    570..824
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     Region: Solcar 2"
     misc_feature    570..629
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     transmembrane region"
     misc_feature    576..833
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     cl28162"
                     /db_xref="CDD:332982"
     misc_feature    759..821
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     transmembrane region"
     misc_feature    852..1115
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /note="Mitochondrial carrier protein; Region: Mito_carr;
                     cl28162"
                     /db_xref="CDD:332982"
     misc_feature    861..1112
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     Region: Solcar 3"
     misc_feature    867..929
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     transmembrane region"
     misc_feature    1026..1091
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9H1U9.1);
                     transmembrane region"
     variation       225
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760638785"
     variation       228
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775668305"
     variation       240
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200137723"
     variation       246
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368075157"
     variation       255
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745814493"
     variation       256
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778607833"
     variation       258
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198045408"
     variation       260
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141127395"
     variation       269
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:968290218"
     variation       271
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777262867"
     variation       279
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1436661707"
     variation       286
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564866952"
     variation       287
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148608996"
     variation       291
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329788318"
     variation       312
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162120919"
     variation       319
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1394966225"
     variation       326
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165691308"
     variation       328
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780863868"
     variation       331
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758909213"
     variation       340
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750961221"
     variation       353
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1450624984"
     variation       359
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765902687"
     variation       360
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370897815"
     variation       368
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754268179"
     variation       370
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1266424788"
     variation       374
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203328617"
     variation       376
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1329431314"
     variation       389
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761495420"
     variation       393
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1305445632"
     variation       395
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1235426302"
     variation       398
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1165950855"
     variation       399
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764179809"
     variation       404
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:61998253"
     variation       405
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1369621958"
     variation       406
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1301089835"
     variation       410
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772139897"
     variation       413
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759674617"
     variation       420
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:553138528"
     variation       421
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192601799"
     variation       429
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4008248"
     variation       433
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1441721315"
     variation       436
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246745543"
     variation       437
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191121010"
     variation       442
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368589487"
     variation       445
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:748998908"
     variation       447
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434406538"
     variation       450
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199040323"
     variation       451
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422275608"
     variation       456
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375522315"
     variation       457
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:769274693"
     variation       462
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747842414"
     variation       464
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1172318963"
     variation       466
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781058130"
     variation       473
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1266815084"
     variation       474
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:754522625"
     variation       475
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371293621"
     variation       477
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1426256604"
     variation       480..484
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1564067272"
     variation       484
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1462759921"
     variation       485
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1479445128"
     variation       487
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1293463597"
     variation       489
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1389291862"
     variation       491
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144071827"
     variation       501
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1205448532"
     variation       505
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757812431"
     variation       506
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138500752"
     variation       512
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764528839"
     variation       516
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1246444780"
     variation       517
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377690500"
     variation       518
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1318356090"
     variation       531
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:900415603"
     variation       534
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:267602239"
     variation       542
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752907578"
     variation       544
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:115761177"
     variation       553
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3855763"
     variation       554
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3865396"
     variation       555
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1564067218"
     variation       556
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201618001"
     variation       564
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:4008249"
     variation       567
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370362775"
     variation       569
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1311183017"
     variation       573
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766180352"
     variation       579
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762963829"
     variation       582
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376597826"
     variation       583
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486991980"
     variation       585
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:4008250"
     variation       586
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4008251"
     variation       588
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1195409532"
     variation       590
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769627872"
     variation       591
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747952145"
     variation       595
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776400711"
     variation       596
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373288644"
     variation       608
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746476887"
     variation       611
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147078712"
     variation       612
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1483535613"
     variation       615
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3865395"
     variation       629
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1260007942"
     variation       635
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1459935658"
     variation       636
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757644573"
     variation       645
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1318451546"
     variation       650
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749803632"
     variation       653
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778205756"
     variation       663
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3855762"
     variation       665
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369201550"
     variation       671
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2296204"
     variation       672
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1397925581"
     variation       677
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1403003010"
     variation       687
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767690431"
     variation       689
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1452301633"
     variation       690..691
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:750934149"
     variation       690
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:755217670"
     variation       698
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4008240"
     variation       702
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:551338195"
     variation       709
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766485848"
     variation       711
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763010031"
     variation       712
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1039458118"
     variation       713
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1564067106"
     variation       728..729
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1564067101"
     variation       728
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1423833598"
     variation       739
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773188045"
     variation       741
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375192827"
     variation       746
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761668955"
     variation       752
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:942397869"
     variation       755
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776597120"
     variation       758
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768372373"
     variation       759
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760415359"
     variation       762
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1247273539"
     variation       767
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350864186"
     variation       768
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341101846"
     variation       769
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373004614"
     variation       772
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771603388"
     variation       773
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1368043682"
     variation       776
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:745423034"
     variation       781..800
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="gcaatgtcttgtttttcggc"
                     /replace="gcaatgtcttgtttttcggcaatgtcttgtttttcggc"
                     /db_xref="dbSNP:1190458689"
     variation       786
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778316437"
     variation       787
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1392756984"
     variation       791
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369844946"
     variation       797
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1458122274"
     variation       798
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748466748"
     variation       801
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1425873051"
     variation       804
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781553381"
     variation       807..808
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:767964579"
     variation       809
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1554693409"
     variation       813
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113788199"
     variation       821
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184766570"
     variation       825
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138756351"
     variation       830
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751776838"
     variation       831
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757259514"
     variation       833
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1466923626"
     variation       834
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1345842098"
     variation       837
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1274850524"
     variation       838
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780199922"
     variation       839
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758483371"
     variation       841
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250821998"
     variation       842
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750508445"
     variation       844
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765181493"
     variation       845
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1298916251"
     variation       846
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1440853584"
     variation       852
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761863244"
     variation       854
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325991164"
     variation       855
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4008241"
     variation       862
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753627150"
     variation       863
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139008167"
     variation       873
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4008242"
     variation       878
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760611633"
     variation       884
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2296205"
     variation       885
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771666313"
     variation       888
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:927942201"
     variation       893
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:980755335"
     variation       894
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1248222146"
     variation       894
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1452550402"
     variation       896
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150196013"
     variation       902
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1484446036"
     variation       908
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773758473"
     variation       910
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4008243"
     variation       917
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1250004337"
     variation       920
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1194310474"
     variation       929..933
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:762213439"
     variation       929
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438442885"
     variation       936
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371433133"
     variation       937
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748660892"
     variation       938
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1408831111"
     variation       939
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432605324"
     variation       941
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781715581"
     variation       954
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1564066956"
     variation       961
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1174222844"
     variation       965
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1207005390"
     variation       968
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768995773"
     variation       975
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:565749472"
     variation       979
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200388144"
     variation       1000
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1330485724"
     variation       1005
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:549183858"
     variation       1010
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750466659"
     variation       1020
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778871693"
     variation       1031
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367640995"
     variation       1032
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432774030"
     variation       1037
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202180917"
     variation       1039
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1366307351"
     variation       1047
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173095636"
     variation       1051
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764180726"
     variation       1052
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760521610"
     variation       1056
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1025540609"
     variation       1057
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1180239894"
     variation       1058
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302765336"
     variation       1060
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752469159"
     variation       1062
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1554693364"
     variation       1064
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054562"
     variation       1072
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1054566"
     variation       1074
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1054567"
     variation       1076
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252598376"
     variation       1077
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1210331177"
     variation       1080
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371733813"
     variation       1083
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484974465"
     variation       1084
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1281255479"
     variation       1087
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1232586573"
     variation       1090
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1197603007"
     variation       1094
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1201539831"
     variation       1100
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:767153901"
     variation       1101
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759126015"
     variation       1103
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1257869931"
     variation       1106..1108
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="aaa"
                     /replace="aaaaaaaaa"
                     /db_xref="dbSNP:1229831124"
     variation       1106
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:814051"
     variation       1109..1112
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace=""
                     /replace="ggtt"
                     /db_xref="dbSNP:1350792761"
     variation       1109
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:9969709"
     variation       1110
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9969708"
     variation       1114
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1292131640"
     variation       1116..1117
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:1360404434"
     variation       1117
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776453751"
     variation       1119
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765870530"
     variation       1124
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762509977"
     variation       1126
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777100692"
     variation       1127
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1054568"
     variation       1128
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1480909391"
     variation       1132
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769192015"
     variation       1133
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1054569"
     variation       1134
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747358827"
     variation       1137
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775740254"
     variation       1138
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1187497716"
     variation       1140
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471815979"
     variation       1154..1155
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1211388631"
     variation       1154
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772277802"
     variation       1157
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746080216"
     variation       1159..1163
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="ct"
                     /replace="cttct"
                     /db_xref="dbSNP:752010271"
     variation       1162
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779341194"
     variation       1165
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757396205"
     variation       1169
                     /gene="SLC25A51"
                     /gene_synonym="CG7943; MCART1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283364160"
ORIGIN      
agtctgcgcctgcgcgggccccggctcgctagccgtcctgcgggacgccggcgctgatgggaaatccagttatcaaaattgactcaagaagagagaacctaacagaacaataacaatggaagaaattgggaacattatcacaaagctatcatcctgccaaactccaggctcagatgtcacaggttaaaaaaagtccttcatgaaaaagaaagatcttaagcagcatgatggattcagaagctcatgaaaagaggccaccaatactaacatcttcaaaacaagatatatcacctcatattacaaatgttggtgagatgaagcattacttgtgtggctgctgtgcagccttcaacaatgtcgcaatcacatttcccattcagaaggtcctctttcgacaacagctgtatggcatcaaaacccgggatgcaatacttcagttgagaagggatggatttcgaaatttgtatcgtggaatccttcccccattgatgcagaagacaactacgcttgcacttatgtttggtctgtatgaggatttatcctgccttctccacaagcatgtcagtgctccagagtttgcaaccagtggcgtggcggcagtgcttgcagggacaacagaagcaattttcactccactggaaagagttcagacattgcttcaagaccacaagcatcatgacaaatttaccaacacttaccaggctttcaaggcactgaaatgtcatggaattggagagtattatcgaggcttggtgcccattcttttccggaatggactcagcaatgtcttgtttttcggccttcgaggtcccattaaggagcatctgcctaccgcaacgactcacagtgctcatctggtcaatgattttatctgtggaggtctattgggtgccatgttgggattcttgttttttccaattaatgttgtaaaaactcgcatacagtctcagattggtggggaatttcagtctttccccaaggttttccaaaaaatctggctggaacgggacagaaaactgataaatcttttcagaggtgcccatctgaattaccatcggtccctcatctcttggggcataatcaatgcaacttatgagttcttgttaaaggttatatgaaaaaaccatcagttaagtgccatttatcaactgaatagaccttctaagaagaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]