GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-06-02 01:20:42, GGRNA.v2 : RefSeq release 200 (May, 2020)

LOCUS       NM_032753               2162 bp    mRNA    linear   PRI 19-OCT-2019
DEFINITION  Homo sapiens retina and anterior neural fold homeobox 2 (RAX2),
            transcript variant 2, mRNA.
ACCESSION   NM_032753
VERSION     NM_032753.4
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2162)
  AUTHORS   Yang P, Chiang PW, Weleber RG and Pennesi ME.
  TITLE     Autosomal Dominant Retinal Dystrophy With Electronegative Waveform
            Associated With a Novel RAX2 Mutation
  JOURNAL   JAMA Ophthalmol 133 (6), 653-661 (2015)
   PUBMED   25789692
  REMARK    GeneRIF: A frameshift heterozygous mutation in RAX2 inherited in an
            autosomal dominant fashion was associated with mixed cone and rod
            dysfunction.
REFERENCE   2  (bases 1 to 2162)
  AUTHORS   Davila S, Froeling FE, Tan A, Bonnard C, Boland GJ, Snippe H,
            Hibberd ML and Seielstad M.
  TITLE     New genetic associations detected in a host response study to
            hepatitis B vaccine
  JOURNAL   Genes Immun. 11 (3), 232-238 (2010)
   PUBMED   20237496
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 2162)
  AUTHORS   Vaquerizas JM, Kummerfeld SK, Teichmann SA and Luscombe NM.
  TITLE     A census of human transcription factors: function, expression and
            evolution
  JOURNAL   Nat. Rev. Genet. 10 (4), 252-263 (2009)
   PUBMED   19274049
  REMARK    Review article
REFERENCE   4  (bases 1 to 2162)
  AUTHORS   Wang QL, Chen S, Esumi N, Swain PK, Haines HS, Peng G, Melia BM,
            McIntosh I, Heckenlively JR, Jacobson SG, Stone EM, Swaroop A and
            Zack DJ.
  TITLE     QRX, a novel homeobox gene, modulates photoreceptor gene expression
  JOURNAL   Hum. Mol. Genet. 13 (10), 1025-1040 (2004)
   PUBMED   15028672
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC005777.1, BC018709.1 and
            AY211277.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Jun 2, 2019 this sequence version replaced NM_032753.3.
            
            Summary: This gene encodes a homeodomain-containing protein that
            plays a role in eye development. Mutation of this gene causes
            age-related macular degeneration type 6, an eye disorder resulting
            in accumulations of protein and lipid beneath the retinal pigment
            epithelium and within the Bruch's membrane. Defects in this gene
            can also cause cone-rod dystrophy type 11, a disease characterized
            by the initial degeneration of cone photoreceptor cells and
            resulting in loss of color vision and visual acuity, followed by
            the degeneration of rod photoreceptor cells, which progresses to
            night blindness and the loss of peripheral vision. Alternative
            splicing results in multiple transcript variants. [provided by
            RefSeq, Jan 2016].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AY211277.1, BQ639073.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           SAMN01820699 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-7                 AC005777.1         8911-8917           c
            8-17                BC018709.1         1-10
            18-1073             AY211277.1         2-1057
            1074-1495           BC018709.1         1326-1747
            1496-1944           AY211277.1         1481-1929
            1945-2145           BC018709.1         2199-2399
            2146-2157           AY211277.1         2131-2142
            2158-2162           BC018709.1         2412-2416
FEATURES             Location/Qualifiers
     source          1..2162
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19p13.3"
     gene            1..2162
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="retina and anterior neural fold homeobox 2"
                     /db_xref="GeneID:84839"
                     /db_xref="HGNC:HGNC:18286"
                     /db_xref="MIM:610362"
     exon            1..66
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /inference="alignment:Splign:2.1.0"
     variation       4
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150444854"
     variation       5
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370564299"
     variation       9
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912749730"
     variation       11
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1206517243"
     variation       14
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1407741009"
     variation       16
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886054371"
     variation       18
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959858612"
     variation       19
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:576680324"
     variation       25
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1403744575"
     variation       26
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1431138226"
     variation       26
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322471973"
     variation       35
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1234677376"
     variation       36
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1372937839"
     variation       37
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1271892443"
     variation       39
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306578133"
     variation       41
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445635462"
     variation       43
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:920193014"
     variation       44
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:974261994"
     variation       45
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1299442229"
     variation       47
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1464980540"
     variation       48
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:994833506"
     variation       49
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:563046576"
     variation       52..65
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gggc"
                     /replace="gggctgccgtgggc"
                     /db_xref="dbSNP:572518936"
     variation       53
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1436920396"
     variation       54
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182965071"
     variation       55
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1178230926"
     variation       58
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1440609438"
     variation       59
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252745152"
     variation       60
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1184528094"
     variation       63
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218333531"
     variation       65
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776666200"
     variation       66
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:981516220"
     exon            67..291
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /inference="alignment:Splign:2.1.0"
     variation       69
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757287837"
     variation       72
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1305855323"
     variation       75
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1444896908"
     CDS             76..630
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="retina and anterior neural fold homeobox like 1;
                     Q50-type retinal homeobox protein; retina and anterior
                     neural fold homeobox-like protein 1"
                     /codon_start=1
                     /product="retina and anterior neural fold homeobox protein
                     2"
                     /protein_id="NP_116142.1"
                     /db_xref="CCDS:CCDS12112.1"
                     /db_xref="GeneID:84839"
                     /db_xref="HGNC:HGNC:18286"
                     /db_xref="MIM:610362"
                     /translation="
MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRLPEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA"
     misc_feature    order(157..171,175..177,226..228,244..246,283..285,
                     289..294,301..306,310..318,322..327)
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(163..165,172..174,292..294,301..306,313..315)
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    166..324
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     variation       76
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:966492816"
     variation       78
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329692934"
     variation       79
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1411731808"
     variation       83
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1020890733"
     variation       86
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1398468087"
     variation       87
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201416315"
     variation       89
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144065007"
     variation       90
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781275318"
     variation       93
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755028810"
     variation       94
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:556179949"
     variation       96..130
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ggggccggcaaccgagggtgggggtctggggccgg"
                     /replace="ggggccggcaaccgagggtgggggtctggggccggcaaccgagggtgg
                     gggtctggggccgg"
                     /db_xref="dbSNP:780405331"
     variation       97
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758091449"
     variation       100
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1181819192"
     variation       101
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750120142"
     variation       102
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764316452"
     variation       108
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149515429"
     variation       109
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:538785333"
     variation       111
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:898244077"
     variation       116
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768008187"
     variation       120
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139127905"
     variation       122
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:751619049"
     variation       124
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:766488722"
     variation       125
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1338805354"
     variation       128
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778194719"
     variation       129
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367658021"
     variation       132
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769403788"
     variation       133
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374434635"
     variation       140
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1406715423"
     variation       144
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1568401195"
     variation       145..153
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aagaag"
                     /replace="aagaagaag"
                     /db_xref="dbSNP:756505075"
     variation       145
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:553002220"
     variation       151
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370364475"
     variation       157
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779669577"
     variation       158
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199546013"
     variation       159
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:535943685"
     variation       162
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778633054"
     variation       166
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200153795"
     variation       167
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373009969"
     variation       170
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225721432"
     variation       174
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1187429141"
     variation       181
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781588193"
     variation       183
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755448810"
     variation       187
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056190175"
     variation       191
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752094189"
     variation       192
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:766400493"
     variation       195
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1473615092"
     variation       202
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763112380"
     variation       205
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761987436"
     variation       206
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370757303"
     variation       207
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768600946"
     variation       208
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760640216"
     variation       209
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775581464"
     variation       210
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1163670829"
     variation       213
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771416905"
     variation       214
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201124970"
     variation       216
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778346457"
     variation       217
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770597544"
     variation       219
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748981950"
     variation       222
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781498623"
     variation       223
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565566531"
     variation       225..226
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ggatgtgtacagcctg"
                     /db_xref="dbSNP:1283758565"
     variation       225
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752009578"
     variation       226..229
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ggatgtgtacagcctgtaca"
                     /replace="tacc"
                     /db_xref="dbSNP:1568401113"
     variation       227
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1374530421"
     variation       228
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1214336624"
     variation       229
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337070706"
     variation       230
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:76076446"
     variation       231
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141804618"
     variation       236
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138553345"
     variation       241
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1404557350"
     variation       244
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765285304"
     variation       245
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757454259"
     variation       247
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370195708"
     variation       250
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1085307700"
     variation       252
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:569526421"
     variation       253
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374872032"
     variation       256
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373359134"
     variation       259
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760560608"
     variation       260
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1409952719"
     variation       261
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:775483414"
     variation       267
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1188584260"
     variation       268
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1396257256"
     variation       269
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767485173"
     variation       270
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252557730"
     variation       278
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202149846"
     variation       280
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333788576"
     variation       282
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773887682"
     variation       283
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372266287"
     variation       284
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748896187"
     variation       285
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021707653"
     variation       286
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772852323"
     variation       289
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216053749"
     exon            292..2162
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /inference="alignment:Splign:2.1.0"
     variation       292
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:775877146"
     variation       293
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772356880"
     variation       294
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1258539834"
     variation       300
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:574101760"
     variation       301
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1316964484"
     variation       306
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308593558"
     variation       307
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746321949"
     variation       308
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:398124430"
     variation       309
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1055074641"
     variation       310
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294461966"
     variation       311
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779301810"
     variation       313
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039500182"
     variation       317
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1359067275"
     variation       318
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:757897383"
     variation       322
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1407392654"
     variation       323
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749374386"
     variation       325
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148629445"
     variation       326
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:573043030"
     variation       330
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474928513"
     variation       333
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1417014277"
     variation       334
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752883776"
     variation       335
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:121908280"
     variation       343
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259459969"
     variation       350
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754730849"
     variation       351
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:751453416"
     variation       353
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262130971"
     variation       354
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:952301557"
     variation       357
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201021639"
     variation       358
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762922416"
     variation       361
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1289584353"
     variation       366
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294479513"
     variation       368
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573892963"
     variation       369
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191051622"
     variation       371
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445024391"
     variation       373
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1242412901"
     variation       374
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1295224576"
     variation       378
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761417697"
     variation       379
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776155252"
     variation       381
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1324110061"
     variation       384
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1463116025"
     variation       389
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772425151"
     variation       390
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:968835887"
     variation       391
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1020556796"
     variation       392
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1371131603"
     variation       392
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1462895070"
     variation       394
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759806695"
     variation       395
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774846243"
     variation       396
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771534203"
     variation       399
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749859588"
     variation       400
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467659356"
     variation       402
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273209818"
     variation       403
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777949969"
     variation       404
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030315829"
     variation       405..410
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccccc"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1230788366"
     variation       406
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1251233912"
     variation       409..495
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ccggccatgtcgctgcccctggagccctggttgggccccggaccgccg
                     gccgtgccaggcctcccccgcctcctgggcccgggcccg"
                     /db_xref="dbSNP:1568400617"
     variation       409
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770022976"
     variation       410
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781281689"
     variation       411..412
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1286946201"
     variation       411
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568400696"
     variation       415
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1002124313"
     variation       416
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1301564042"
     variation       419
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:398124431"
     variation       420
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755282511"
     variation       424
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:900588930"
     variation       425
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751304733"
     variation       426
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1184300868"
     variation       429
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1409720236"
     variation       433
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1045743925"
     variation       439
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1173290478"
     variation       440
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1427343992"
     variation       441
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1016261221"
     variation       443
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779877505"
     variation       444
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1167236192"
     variation       445
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1005347152"
     variation       447
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:888248705"
     variation       448
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:950155665"
     variation       450
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1412019106"
     variation       452..466
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="cgccggccgtgccag"
                     /db_xref="dbSNP:1342399719"
     variation       452
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537165398"
     variation       453
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929891283"
     variation       455
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1253237453"
     variation       456
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:895500531"
     variation       458..459
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1274933809"
     variation       459
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1195021627"
     variation       460
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758285438"
     variation       462
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1037108094"
     variation       463
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1250490026"
     variation       467
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:937125036"
     variation       471
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577841273"
     variation       472
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1481836442"
     variation       473
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1278560302"
     variation       475
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:941526473"
     variation       476
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:910094615"
     variation       478
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1305878885"
     variation       483..497
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gggcccgggcccggg"
                     /replace="gggcccgggcccgggcccggg"
                     /db_xref="dbSNP:549932754"
     variation       484
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:121908281"
     variation       486
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1248541458"
     variation       488
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978473853"
     variation       489..491
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1328132335"
     variation       489
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1335212510"
     variation       494
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:750394661"
     variation       495
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947549671"
     variation       497
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1391061686"
     variation       498
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1431848727"
     variation       499..513
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="ctgcaagcgtccttc"
                     /db_xref="dbSNP:1568400594"
     variation       501
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1310919721"
     variation       504
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:922236026"
     variation       505
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113176673"
     variation       506
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:989493054"
     variation       507
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149918940"
     variation       513
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468184577"
     variation       514
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:957818577"
     variation       516
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761243587"
     variation       517
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1183181146"
     variation       518..521
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ctca"
                     /db_xref="dbSNP:1256017785"
     variation       519
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1439994082"
     variation       521
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1230148971"
     variation       530
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753446591"
     variation       534
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486188826"
     variation       536
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1282782912"
     variation       539..550
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="t"
                     /replace="tcgcagatggct"
                     /db_xref="dbSNP:886041039"
     variation       539
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203569849"
     variation       540
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:923302208"
     variation       541
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280147395"
     variation       544
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1241272400"
     variation       547..548
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1449763445"
     variation       547
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1352324861"
     variation       552
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763649255"
     variation       553
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:760415111"
     variation       554
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016314982"
     variation       555
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906473424"
     variation       562
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:534656129"
     variation       565
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1335805560"
     variation       566
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771442676"
     variation       567
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1014225698"
     variation       569
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112538462"
     variation       570
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1165336895"
     variation       574
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771011757"
     variation       575
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:202103390"
     variation       576
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1451579585"
     variation       579
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388641253"
     variation       581
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1416399047"
     variation       584
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1187818180"
     variation       585
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:941485794"
     variation       589
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773857866"
     variation       595
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1239523974"
     variation       599
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191315157"
     variation       610
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1025462223"
     variation       613
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567006348"
     variation       619
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1285206637"
     variation       620
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1207025589"
     variation       621
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:769934766"
     variation       622
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1271231378"
     variation       627
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291600031"
     variation       637
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781395665"
     variation       638
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778410291"
     variation       639
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1285669869"
     variation       643
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1428380234"
     variation       644
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325548103"
     variation       645
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1318540795"
     variation       646..648
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1429367131"
     variation       646
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1458393430"
     variation       648
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747281291"
     variation       649
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1391595572"
     variation       651
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1160479173"
     variation       652
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:922852315"
     variation       655
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1462366807"
     variation       656
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1416590311"
     variation       657
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1185206434"
     variation       658
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756545759"
     variation       659
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748592898"
     variation       661..663
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1190712383"
     variation       668
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026466064"
     variation       669
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252389963"
     variation       675
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139146360"
     variation       676
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:989221840"
     variation       678
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:745749097"
     variation       681
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291917539"
     variation       682
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:536413590"
     variation       686
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467312373"
     variation       690
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1424440320"
     variation       700
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112751250"
     variation       703
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1568400427"
     variation       704
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1483737658"
     variation       709
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1431974527"
     variation       717
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1255859869"
     variation       718
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886054369"
     variation       719
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1033493718"
     variation       724
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:980576702"
     variation       727
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1488585056"
     variation       734..735
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1362646101"
     variation       735
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237258627"
     variation       736
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:970979540"
     variation       738
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:905498355"
     variation       745
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:781429367"
     variation       750..759
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccaccac"
                     /replace="ccaccaccac"
                     /db_xref="dbSNP:1308390277"
     variation       757
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413987028"
     variation       759
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1042846985"
     variation       764
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:947103494"
     variation       767
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:866964205"
     variation       768
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:913433357"
     variation       770
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1053284032"
     variation       772
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:933609200"
     variation       774..780
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="agaga"
                     /replace="agagaga"
                     /db_xref="dbSNP:765073500"
     variation       775
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993823380"
     variation       777
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:923552826"
     variation       781
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1254402355"
     variation       788
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:567541177"
     variation       799
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:897149979"
     variation       800
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1232391378"
     variation       803
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177076931"
     variation       809
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1310390260"
     variation       810
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:964698261"
     variation       812
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:550787935"
     variation       816
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1392935828"
     variation       821
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150808899"
     variation       824
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11883056"
     variation       825
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1449281671"
     variation       831
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:565417258"
     variation       832
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:551480253"
     variation       837
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1388634597"
     variation       845
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:994017656"
     variation       846
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568400336"
     variation       857..858
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:1041298455"
     variation       861
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:960109331"
     variation       869
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:528491190"
     variation       870
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1361448002"
     variation       877
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1177239922"
     variation       878
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418917467"
     variation       887
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1001431049"
     variation       893
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1568400313"
     variation       896
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:913557579"
     variation       900
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1378865918"
     variation       901..904
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1176327693"
     variation       901
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142875968"
     variation       903
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764972815"
     variation       906
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:936340074"
     variation       910
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374701207"
     variation       923
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1421413127"
     variation       933
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1426473530"
     variation       939
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:905552147"
     variation       947
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1042733352"
     variation       948
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1199440183"
     variation       950
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1482220318"
     variation       951
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:926331334"
     variation       954
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:980936242"
     variation       955
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011366370"
     variation       956
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:559347055"
     variation       962
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1025265039"
     variation       963
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:971995911"
     variation       969
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1053243121"
     variation       970
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306842943"
     variation       973
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:542961923"
     variation       974
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016156373"
     variation       977
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1377984760"
     variation       978
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573855282"
     variation       979
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1243525279"
     variation       987
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1005482654"
     variation       988
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474208449"
     variation       993
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:540904191"
     variation       994
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:563450780"
     variation       995
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1039283695"
     variation       998
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756898228"
     variation       999
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:543676430"
     variation       1000
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984751573"
     variation       1004
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929269038"
     variation       1009
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771616343"
     variation       1011
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73531473"
     variation       1012
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:992623473"
     variation       1013
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1430276600"
     variation       1022
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303799978"
     variation       1036..1040
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ct"
                     /replace="ctcct"
                     /db_xref="dbSNP:1381728838"
     variation       1045
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1421119688"
     variation       1060
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:959918734"
     variation       1061
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945630878"
     variation       1062
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:892698318"
     variation       1077
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147235958"
     variation       1082
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1568400222"
     variation       1083
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370569469"
     variation       1088
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1444989966"
     variation       1092
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1214548921"
     variation       1100..1108
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="agcagc"
                     /replace="agcagcagc"
                     /db_xref="dbSNP:926277551"
     variation       1103
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1237853883"
     variation       1107
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:753823753"
     variation       1109
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1229209654"
     variation       1111..1121
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="ccgcgagcctg"
                     /db_xref="dbSNP:1176991714"
     variation       1112
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1035915540"
     variation       1113
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:980045637"
     variation       1114
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:534280724"
     variation       1115
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753371180"
     variation       1117
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1405801682"
     variation       1120
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1011252751"
     variation       1121
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1400360122"
     variation       1124..1129
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ctc"
                     /replace="ctcctc"
                     /db_xref="dbSNP:1377680439"
     variation       1131
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:891425007"
     variation       1135
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1312626875"
     variation       1139
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917743185"
     variation       1142
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764144252"
     variation       1143
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1280789566"
     variation       1147
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:542850364"
     variation       1154
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961867623"
     variation       1157
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1242900798"
     variation       1158
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1342272741"
     variation       1165
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573611356"
     variation       1166
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:997655392"
     variation       1167..1168
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1208537861"
     variation       1168
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1399881648"
     variation       1172
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:984676271"
     variation       1176
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1483346450"
     variation       1182
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760554835"
     variation       1183
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:902037235"
     variation       1184
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1469652297"
     variation       1207
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1191809118"
     variation       1209
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:747650052"
     variation       1213
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1039169289"
     variation       1216
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397168431"
     variation       1220
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401066152"
     variation       1221
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:558372260"
     variation       1224
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1385213687"
     variation       1235
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1028777617"
     variation       1249
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371486734"
     variation       1251
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1412143938"
     variation       1253
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775459770"
     variation       1254
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886054368"
     variation       1257
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:965869191"
     variation       1258
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:888032282"
     variation       1260
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:572021504"
     variation       1262
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929336441"
     variation       1264
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279361854"
     variation       1265
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1339777439"
     variation       1266
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1197510704"
     variation       1271
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767221990"
     variation       1276
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:992280356"
     variation       1277
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112369501"
     variation       1280
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1254957896"
     variation       1284
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1010119724"
     variation       1292
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:892645756"
     variation       1297
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477435359"
     variation       1304
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778568577"
     variation       1305
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1568400098"
     variation       1306
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:928487890"
     variation       1309
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:576669713"
     variation       1310
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28673245"
     variation       1311
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1447305599"
     variation       1313
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1001154925"
     variation       1317
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208248243"
     variation       1319
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115071988"
     variation       1320
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:949142739"
     variation       1331..1337
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gagag"
                     /replace="gagagag"
                     /db_xref="dbSNP:1326625879"
     variation       1337..1339
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1229405773"
     variation       1337
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1302183750"
     variation       1346
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1218137292"
     variation       1347
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1316593410"
     variation       1348..1350
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1467155450"
     variation       1348
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:990041035"
     variation       1350..1354
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="gccag"
                     /db_xref="dbSNP:138512126"
     variation       1350
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917547"
     variation       1352
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1031739378"
     variation       1367
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448942088"
     variation       1372
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1322007235"
     variation       1380
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:571601214"
     variation       1381
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:901586216"
     variation       1384
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1473418462"
     variation       1386
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1167665146"
     variation       1388
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419425408"
     variation       1390
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459454439"
     variation       1392
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1324612320"
     variation       1396
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1325985778"
     variation       1398..1403
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="gtc"
                     /replace="gtcgtc"
                     /db_xref="dbSNP:1315969232"
     variation       1400
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017267736"
     variation       1401
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1007689446"
     variation       1404
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1568400025"
     variation       1406
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:887917665"
     variation       1407
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:551864984"
     variation       1409
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332561160"
     variation       1413
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1232812430"
     variation       1414
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:929531306"
     variation       1415
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917546"
     variation       1418
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1203554366"
     variation       1423
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:965420416"
     variation       1424
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1486178205"
     variation       1425
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190471891"
     variation       1434
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1196540731"
     variation       1435..1438
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1163670662"
     variation       1435
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1056861754"
     variation       1436
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256086044"
     variation       1437
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:939491559"
     variation       1442
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1020082058"
     variation       1443
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1455038195"
     variation       1445
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:926699833"
     variation       1449
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1009656822"
     variation       1451
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1415213441"
     variation       1453
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143706741"
     variation       1460
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:956854433"
     variation       1463
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1414019055"
     variation       1465
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1307810901"
     variation       1466
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1032544180"
     variation       1468
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1456459740"
     variation       1470
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1237193177"
     variation       1494
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1260399047"
     variation       1496
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:917545"
     variation       1497
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:948551826"
     variation       1500
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:914387817"
     variation       1503
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148990863"
     variation       1512
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:956141720"
     variation       1516
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:924339003"
     variation       1518
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773142284"
     variation       1524
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:940480224"
     variation       1525
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:887600199"
     variation       1526
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1434048965"
     variation       1529
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298636383"
     variation       1531
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1375397350"
     variation       1532
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:10405125"
     variation       1533
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332448820"
     variation       1534..1537
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1301722451"
     variation       1534
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:921814565"
     variation       1539
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181573768"
     variation       1540
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372452808"
     variation       1547
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017319851"
     variation       1548
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748630795"
     variation       1553
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1479931544"
     variation       1555
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1193642513"
     variation       1557
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1236961921"
     variation       1558
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1007241070"
     variation       1565..1574
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="cggctggccc"
                     /db_xref="dbSNP:1332818881"
     variation       1565
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1195058130"
     variation       1566
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1397448144"
     variation       1579
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886054367"
     variation       1585
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1410443397"
     variation       1589
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:912603253"
     variation       1593
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1170592457"
     variation       1601
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:988214081"
     variation       1602
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:886054366"
     variation       1604
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:866962886"
     variation       1607
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:956803181"
     variation       1614
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1478922343"
     variation       1619
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1324090700"
     variation       1625
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032491752"
     variation       1626
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1395475559"
     variation       1636
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:979570262"
     variation       1647
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:969593840"
     variation       1648
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306273569"
     variation       1649
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:543639717"
     variation       1650
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256894327"
     variation       1654
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1468504582"
     variation       1656
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1214979146"
     variation       1663
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1487944852"
     variation       1665
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:533160062"
     variation       1668
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:896134547"
     variation       1670
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1426676688"
     variation       1683
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1014572912"
     variation       1684
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368356816"
     variation       1685
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442343282"
     variation       1702..1722
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="cccagatcac"
                     /replace="cccagatcactcccagatcac"
                     /db_xref="dbSNP:143816706"
     variation       1706
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1277188766"
     variation       1707
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:898071508"
     variation       1710
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348964458"
     variation       1713..1723
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="cccagatcacc"
                     /db_xref="dbSNP:945501026"
     variation       1728
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1238911098"
     variation       1734
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1056680876"
     variation       1743
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1003963778"
     variation       1744
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:865777598"
     variation       1749
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1442389569"
     variation       1760
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:905167387"
     variation       1764
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332048126"
     variation       1768
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1045194428"
     variation       1774
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781672239"
     variation       1775
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886054365"
     variation       1776..1779
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1476139623"
     variation       1776
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:541141934"
     variation       1778
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192631064"
     variation       1779
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1860322"
     variation       1780
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1162883673"
     variation       1782
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413091180"
     variation       1787
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1401523830"
     variation       1791
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1054691513"
     variation       1792
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1343621605"
     variation       1793
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1419530134"
     variation       1798
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934470760"
     variation       1799
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554924169"
     variation       1802
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1413407200"
     variation       1807
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1418058981"
     variation       1809
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1377751315"
     variation       1811
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382467055"
     variation       1812
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778752074"
     variation       1814
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1177835874"
     variation       1820
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472474640"
     variation       1821
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1235809993"
     variation       1824
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:965701181"
     variation       1830
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:910201278"
     variation       1832
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190171660"
     variation       1835
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:886054364"
     variation       1839
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:935335961"
     variation       1840..1842
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace=""
                     /replace="att"
                     /db_xref="dbSNP:1185647890"
     variation       1841..1851
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="tttttttttt"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /db_xref="dbSNP:969959848"
     variation       1842
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925325878"
     variation       1851
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:541461753"
     variation       1852
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406131291"
     variation       1855
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1023841184"
     variation       1863
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174657273"
     variation       1866
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1377596244"
     variation       1867
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:992808097"
     variation       1869
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:951791249"
     variation       1873
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751574450"
     variation       1874
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1442366753"
     variation       1880
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1027862612"
     variation       1882
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1374286742"
     variation       1886
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:994076896"
     variation       1887
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756949675"
     variation       1888
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:753483270"
     variation       1897
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1004477347"
     variation       1906
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1208421186"
     variation       1915
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:879270537"
     variation       1921
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:887452255"
     variation       1924
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1206792435"
     variation       1930
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1568399751"
     variation       1933
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:796661165"
     variation       1945
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1439336622"
     variation       1946
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1281958115"
     variation       1947
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397310167"
     variation       1948
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1450074262"
     variation       1950
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995978121"
     variation       1954
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138882802"
     variation       1956
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1420924451"
     variation       1957..1960
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:1412126974"
     variation       1958
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556680562"
     variation       1963
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397971978"
     variation       1966
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1362231528"
     variation       1968
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:905221601"
     variation       1969..1971
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:533827006"
     variation       1970
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1009209788"
     variation       1972
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1405019314"
     variation       1973
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557232331"
     variation       1979
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:8103165"
     variation       1988
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537209342"
     variation       1989
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1274021560"
     variation       1990
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1339993241"
     variation       1994
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:893896630"
     variation       1996
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:6510769"
     variation       1998
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:557945632"
     variation       2020
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1457343900"
     variation       2040
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:925315867"
     variation       2041
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1043827967"
     variation       2052
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948193256"
     variation       2058
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:934501930"
     variation       2061
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1373931425"
     variation       2064
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:535098347"
     variation       2065
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1166622663"
     variation       2072
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1263184456"
     variation       2075
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:902992031"
     variation       2076
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040718133"
     variation       2086
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1164987642"
     variation       2096
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566212226"
     variation       2103
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1489443433"
     variation       2105
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:992317695"
     variation       2107
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1322664820"
     variation       2113
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886054363"
     variation       2119
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1326759579"
     variation       2120
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432848167"
     variation       2123
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276277511"
     variation       2132
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:961173478"
     variation       2141..2146
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1234040876"
     variation       2144..2150
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aaa"
                     /replace="aaacaaa"
                     /db_xref="dbSNP:1450710786"
     variation       2147
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1275122025"
     variation       2150
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:908101133"
     variation       2152
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1287089282"
     variation       2153
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775609621"
     variation       2155..2161
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aaa"
                     /replace="aaacaaa"
                     /db_xref="dbSNP:1449135227"
     variation       2158
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1262903125"
     variation       2159..2162
                     /gene="RAX2"
                     /gene_synonym="ARMD6; CORD11; QRX; RAXL1"
                     /replace="aa"
                     /replace="aaaa"
                     /db_xref="dbSNP:983670157"
ORIGIN      
agacgcagcgccaggcccgctggggcaggtgtcccgtggaaatcgacggaggggctgccgtgggcggtgggagccatgttcctgagcccgggcgaggggccggcaaccgagggtgggggtctggggccgggcgaggaggcccccaagaagaagcaccggaggaaccgcaccaccttcaccacctaccagctgcaccagctggagcgggcgttcgaggcctctcactacccggatgtgtacagccgtgaggagctggcagccaaggtgcacctacctgaggtgcgcgtgcaggtgtggttccagaaccgccgggccaagtggcgccgccaggagcggctggagtcaggctcgggtgccgtggcagctccgagactccccgaggccccagcgctgccgttcgcccgccccccggccatgtcgctgcccctggagccctggttgggccccggaccgccggccgtgccaggcctcccccgcctcctgggcccgggcccggggctgcaagcgtccttcgggcctcatgcctttgctcccaccttcgcagatggcttcgccctggaggaggcgtccctgcggctgctggccaaggaacatgcacaggctctggacagggcctggccgccagcctgagcctgccgccctcccgggccccctcctcggcccaacccgagaaccggggacgtgccctggtgacagccaccacgccttggcctaggccgaggtcatggagcaaccgtggtcaggccaggccaccaccactggggagcgggaccagagagacaggctgctgggttccctgcccccatcccgtctcccaccccatcgccacccgtcctgctggcagcggactggcccccagtgtcaggcaggaggtgacccaagtattctcaggccaggtgcggggacctcctcccctcctggggcctcagtctcctgtctgttaattgggcgtgggggcctccgaggttcgagggctgcgaggctgtgggtggcgggaccgctgactctgtaagatgagtgtaaatctctctgcttctcctaatccccatcagcagagctgcccactctccaggctcccagtcccctggaaataacaaatagcagcagctcccgcgagcctggtctcctctcaccgtgtgctcgccatgtgagcactcccctctccgttgtgccctggacctcgggcacagctgtcagcccattctatagagagggaaaccggggcttaggcaggaagccaggtccccaaagtcgcacggccaggagtggatggagctgcctttcagacccatcaccggtcctaccgtccggggcacagcgacaggttctggagagagggtgggtcccgggccaggtgctggtgggcctccaggtggaggcgggctgatgctgggtgtgtcgtcatcgtcagaccgttcctcacgtccccacagaccccaggccctgtgcatgtccccagtggaggcatggccagcatctgctctgtccaacccagccgcatcgcccaagagctctgagcaaggaggctgtcgcggggccgagaacccgctgggactggcaagcacggctggcccagtgcagcaggagggggccctgaggcatgggatgggacagtctgggccagcgccacctcccgggacagaagtgcggcaccagggcaggagctgcagtagctaccctccccgtctccagcctgggctccccagatcactcccagatcaccaggtcaccccatctctaggcggcacctcacacaccagtcctgtggtccaacgccccgccatcacccaatgtcaccgcacaccaggcagtggggacacggcagtaagcacaagaaagatttttttttttaaagctaaaccaggccaggtgcggtggctcatgcctgtaatcccagtgctttgggaggctgaggtgggaggattgcttgagaccagcctgggtgacacagcaagaccccatctccacaaacgtttttaaaatgtgccgggtgtactggtgcacacctgtcatcccagctacccaagaagctgaggcaagaggatcacttgagcccagaaggtcgaggctgcagggagctgtgatcacactgctgcactccagcctgtgcaacagagccagaccctgactcaatacaaataaaaaacaaatctaaaacaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]