2024-04-19 16:48:40, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_031701 1442 bp mRNA linear ROD 21-MAR-2023 DEFINITION Rattus norvegicus claudin 5 (Cldn5), mRNA. ACCESSION NM_031701 XM_344058 VERSION NM_031701.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1442) AUTHORS Hu Q, Wu C, Yu J, Luo J and Peng X. TITLE Angelica sinensis polysaccharide improves rheumatoid arthritis by modifying the expression of intestinal Cldn5, Slit3 and Rgs18 through gut microbiota JOURNAL Int J Biol Macromol 209 (Pt A), 153-161 (2022) PUBMED 35318077 REMARK GeneRIF: Angelica sinensis polysaccharide improves rheumatoid arthritis by modifying the expression of intestinal Cldn5, Slit3 and Rgs18 through gut microbiota. REFERENCE 2 (bases 1 to 1442) AUTHORS Andersson EA, Rocha-Ferreira E, Hagberg H, Mallard C and Ek CJ. TITLE Function and Biomarkers of the Blood-Brain Barrier in a Neonatal Germinal Matrix Haemorrhage Model JOURNAL Cells 10 (7), 1677 (2021) PUBMED 34359845 REMARK GeneRIF: Function and Biomarkers of the Blood-Brain Barrier in a Neonatal Germinal Matrix Haemorrhage Model. Publication Status: Online-Only REFERENCE 3 (bases 1 to 1442) AUTHORS Rosas-Martinez L, Rodriguez-Munoz R, Namorado-Tonix MDC, Missirlis F, Del Valle-Mondragon L, Sanchez-Mendoza A, Reyes-Sanchez JL and Cervantes-Perez LG. TITLE Hyperglycemic levels in early stage of diabetic nephropathy affect differentially renal expression of claudins-2 and -5 by oxidative stress JOURNAL Life Sci 268, 119003 (2021) PUBMED 33417957 REMARK GeneRIF: Hyperglycemic levels in early stage of diabetic nephropathy affect differentially renal expression of claudins-2 and -5 by oxidative stress. REFERENCE 4 (bases 1 to 1442) AUTHORS Shou J, Peng J, Zhao Z, Huang X, Li H, Li L, Gao X, Xing Y and Liu H. TITLE CCL26 and CCR3 are associated with the acute inflammatory response in the CNS in experimental autoimmune encephalomyelitis JOURNAL J Neuroimmunol 333, 576967 (2019) PUBMED 31151084 REMARK GeneRIF: The expression of claudin-5 in the EAE group was negatively correlated with the inflammation scores. Levels of CCL26 in the serum and brain tissues and the number of CCR3-positive cells in the brain tissues were negatively correlated with the protein expression of claudin-5. REFERENCE 5 (bases 1 to 1442) AUTHORS Berndt P, Winkler L, Cording J, Breitkreuz-Korff O, Rex A, Dithmer S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE and Haseloff RF. TITLE Tight junction proteins at the blood-brain barrier: far more than claudin-5 JOURNAL Cell Mol Life Sci 76 (10), 1987-2002 (2019) PUBMED 30734065 REFERENCE 6 (bases 1 to 1442) AUTHORS Sun ZY, Wei J, Xie L, Shen Y, Liu SZ, Ju GZ, Shi JP, Yu YQ, Zhang X, Xu Q and Hemmings GP. TITLE The CLDN5 locus may be involved in the vulnerability to schizophrenia JOURNAL Eur Psychiatry 19 (6), 354-357 (2004) PUBMED 15363474 REFERENCE 7 (bases 1 to 1442) AUTHORS Wolburg H, Wolburg-Buchholz K, Kraus J, Rascher-Eggstein G, Liebner S, Hamm S, Duffner F, Grote EH, Risau W and Engelhardt B. TITLE Localization of claudin-3 in tight junctions of the blood-brain barrier is selectively lost during experimental autoimmune encephalomyelitis and human glioblastoma multiforme JOURNAL Acta Neuropathol 105 (6), 586-592 (2003) PUBMED 12734665 REFERENCE 8 (bases 1 to 1442) AUTHORS Nitta T, Hata M, Gotoh S, Seo Y, Sasaki H, Hashimoto N, Furuse M and Tsukita S. TITLE Size-selective loosening of the blood-brain barrier in claudin-5-deficient mice JOURNAL J Cell Biol 161 (3), 653-660 (2003) PUBMED 12743111 REFERENCE 9 (bases 1 to 1442) AUTHORS Poliak S, Matlis S, Ullmer C, Scherer SS and Peles E. TITLE Distinct claudins and associated PDZ proteins form different autotypic tight junctions in myelinating Schwann cells JOURNAL J Cell Biol 159 (2), 361-372 (2002) PUBMED 12403818 REMARK GeneRIF: MUPP1 and claudin-5 colocalized in the incisures, and the COOH-terminal region of claudin-5 interacts with MUPP1 in a PSD-95/Disc Large/zona occludens (ZO)-1 (PDZ)-dependent manner in tight junctions REFERENCE 10 (bases 1 to 1442) AUTHORS Morita K, Furuse M, Fujimoto K and Tsukita S. TITLE Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands JOURNAL Proc Natl Acad Sci U S A 96 (2), 511-516 (1999) PUBMED 9892664 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CK479973.1, BC082073.1 and AI029697.1. On Nov 18, 2005 this sequence version replaced NM_031701.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript is intronless :: FQ212855.1, FQ213419.1 [ECO:0000345] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-11 CK479973.1 1-11 12-1424 BC082073.1 10-1422 1425-1442 AI029697.1 1-18 c FEATURES Location/Qualifiers source 1..1442 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="11" /map="11q23" gene 1..1442 /gene="Cldn5" /note="claudin 5" /db_xref="GeneID:65131" /db_xref="RGD:68431" exon 1..1427 /gene="Cldn5" /inference="alignment:Splign:2.1.0" CDS 143..799 /gene="Cldn5" /codon_start=1 /product="claudin-5" /protein_id="NP_113889.1" /db_xref="GeneID:65131" /db_xref="RGD:68431" /translation="
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV"
misc_feature 155..682 /gene="Cldn5" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:451326" misc_feature 164..226 /gene="Cldn5" /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2); transmembrane region" misc_feature 386..448 /gene="Cldn5" /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2); transmembrane region" misc_feature 512..574 /gene="Cldn5" /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2); transmembrane region" misc_feature 623..685 /gene="Cldn5" /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2); transmembrane region" misc_feature 791..796 /gene="Cldn5" /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2); Region: Interactions with TJP1, TJP2 and TJP3. /evidence=ECO:0000250" ORIGIN
tgtggttgaaacctctcttctgttccactgcaagaggctccggagcagaggcaccagaatcagcccccaacccacagcccacgcagcgcagagcgcacccggaggccccaagggccatcgggtgagcattcggtctttagccatggggtctgcagcgttggaaattctgggtctggtgctgtgtctggtaggctgggtgggcttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaatatcgtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagcaccgggcacatgcaatgcaaagtgtatgagtctgtgctggcgctgagcgcggaggtgcaggcagctcgggcactcaccgtgggcgctgtgctgctggcgcttgtggcactctttgttaccttgaccggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtggcactcacgggaggagcgctttatgccctgtgtgggcttctggcactggtgccactctgctggttcgccaacatcgtagtccgggagttctatgatccaacggtgccggtgtctcagaagtacgagctgggcgcggcgctgtacatcggctgggcggcctccgcactgctcatgtgtggcggcggcctcgtgtgctgtggcgcctgggtttgcaccgggcgtccagagttcagttttccagtcaagtactcagcaccaaggcgaaccacggccaacggcgattacgacaagaagaactacgtctaagggcgggaggcacggcggggctcttcccgcagctaagcccgcgttcggaaagaccgatgtgggaagccgcgtgtggatgacgaccaccgctgaattgcgcagcgcagactccgaggcaagttaggttgggttcgggccagacttgcgcgctctcacagagaggggtcgttgatcaacgctagccaggccctgctcagaacagactacaggctcttgtgaggacttgaccgaccttttcttctatgcgcagttggccacgacatggtggaactctaagatttcatcggtgaagtagccaccaaactgccgctaacagttcctactgagtcctggggagtgctggatgctgccttaatgtccggtggtacctgctaacctgaaagggcagctggggaaaccctggggctgccagaggaatgcgttaaaaagggcatttttcttgttagtggagaggaacctactgaaccaaaggacttgccctggacctggtctcattccagcagtcccccaaggtgagggggcctgtaggtaccagagccttagaagggttgccttcctcctcgaagcttggggtttggggggtgggccgggtaagactttgcttagtaaatggtttgaacactttcaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]