GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 16:18:19, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_031701               1442 bp    mRNA    linear   ROD 07-MAR-2021
DEFINITION  Rattus norvegicus claudin 5 (Cldn5), mRNA.
ACCESSION   NM_031701 XM_344058
VERSION     NM_031701.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1442)
  AUTHORS   Rosas-Martinez L, Rodriguez-Munoz R, Namorado-Tonix MDC, Missirlis
            F, Del Valle-Mondragon L, Sanchez-Mendoza A, Reyes-Sanchez JL and
            Cervantes-Perez LG.
  TITLE     Hyperglycemic levels in early stage of diabetic nephropathy affect
            differentially renal expression of claudins-2 and -5 by oxidative
            stress
  JOURNAL   Life Sci 268, 119003 (2021)
   PUBMED   33417957
  REMARK    GeneRIF: Hyperglycemic levels in early stage of diabetic
            nephropathy affect differentially renal expression of claudins-2
            and -5 by oxidative stress.
REFERENCE   2  (bases 1 to 1442)
  AUTHORS   Shou J, Peng J, Zhao Z, Huang X, Li H, Li L, Gao X, Xing Y and Liu
            H.
  TITLE     CCL26 and CCR3 are associated with the acute inflammatory response
            in the CNS in experimental autoimmune encephalomyelitis
  JOURNAL   J Neuroimmunol 333, 576967 (2019)
   PUBMED   31151084
  REMARK    GeneRIF: The expression of claudin-5 in the EAE group was
            negatively correlated with the inflammation scores. Levels of CCL26
            in the serum and brain tissues and the number of CCR3-positive
            cells in the brain tissues were negatively correlated with the
            protein expression of claudin-5.
REFERENCE   3  (bases 1 to 1442)
  AUTHORS   Berndt P, Winkler L, Cording J, Breitkreuz-Korff O, Rex A, Dithmer
            S, Rausch V, Blasig R, Richter M, Sporbert A, Wolburg H, Blasig IE
            and Haseloff RF.
  TITLE     Tight junction proteins at the blood-brain barrier: far more than
            claudin-5
  JOURNAL   Cell Mol Life Sci 76 (10), 1987-2002 (2019)
   PUBMED   30734065
REFERENCE   4  (bases 1 to 1442)
  AUTHORS   Kimura I, Dohgu S, Takata F, Matsumoto J, Kawahara Y, Nishihira M,
            Sakada S, Saisho T, Yamauchi A and Kataoka Y.
  TITLE     Activation of the alpha7 nicotinic acetylcholine receptor
            upregulates blood-brain barrier function through increased
            claudin-5 and occludin expression in rat brain endothelial cells
  JOURNAL   Neurosci Lett 694, 9-13 (2019)
   PUBMED   30452951
  REMARK    GeneRIF: Study, found that the stimulation of alpha7 nicotinic
            acetylcholine receptor but not alpha4beta2 nicotinic acetylcholine
            receptor decreased sodium-fluorescein permeability and increased
            cell transendothelial electrical resistance in rat brain
            endothelial cells (RBEC) monolayers and increased the protein
            levels of claudin-5 and occludin in RBECs.
REFERENCE   5  (bases 1 to 1442)
  AUTHORS   Yang Y, Kimura-Ohba S, Thompson JF, Salayandia VM, Cosse M, Raz L,
            Jalal FY and Rosenberg GA.
  TITLE     Vascular tight junction disruption and angiogenesis in
            spontaneously hypertensive rat with neuroinflammatory white matter
            injury
  JOURNAL   Neurobiol Dis 114, 95-110 (2018)
   PUBMED   29486300
REFERENCE   6  (bases 1 to 1442)
  AUTHORS   Sun ZY, Wei J, Xie L, Shen Y, Liu SZ, Ju GZ, Shi JP, Yu YQ, Zhang
            X, Xu Q and Hemmings GP.
  TITLE     The CLDN5 locus may be involved in the vulnerability to
            schizophrenia
  JOURNAL   Eur Psychiatry 19 (6), 354-357 (2004)
   PUBMED   15363474
REFERENCE   7  (bases 1 to 1442)
  AUTHORS   Wolburg H, Wolburg-Buchholz K, Kraus J, Rascher-Eggstein G, Liebner
            S, Hamm S, Duffner F, Grote EH, Risau W and Engelhardt B.
  TITLE     Localization of claudin-3 in tight junctions of the blood-brain
            barrier is selectively lost during experimental autoimmune
            encephalomyelitis and human glioblastoma multiforme
  JOURNAL   Acta Neuropathol 105 (6), 586-592 (2003)
   PUBMED   12734665
REFERENCE   8  (bases 1 to 1442)
  AUTHORS   Nitta T, Hata M, Gotoh S, Seo Y, Sasaki H, Hashimoto N, Furuse M
            and Tsukita S.
  TITLE     Size-selective loosening of the blood-brain barrier in
            claudin-5-deficient mice
  JOURNAL   J Cell Biol 161 (3), 653-660 (2003)
   PUBMED   12743111
REFERENCE   9  (bases 1 to 1442)
  AUTHORS   Poliak S, Matlis S, Ullmer C, Scherer SS and Peles E.
  TITLE     Distinct claudins and associated PDZ proteins form different
            autotypic tight junctions in myelinating Schwann cells
  JOURNAL   J Cell Biol 159 (2), 361-372 (2002)
   PUBMED   12403818
  REMARK    GeneRIF: MUPP1 and claudin-5 colocalized in the incisures, and the
            COOH-terminal region of claudin-5 interacts with MUPP1 in a
            PSD-95/Disc Large/zona occludens (ZO)-1 (PDZ)-dependent manner in
            tight junctions
REFERENCE   10 (bases 1 to 1442)
  AUTHORS   Morita K, Furuse M, Fujimoto K and Tsukita S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CK479973.1, BC082073.1 and AI029697.1.
            On Nov 18, 2005 this sequence version replaced NM_031701.1.
            
            Summary: a component of tight junctions in myelinating Schwann
            cells [RGD, Feb 2006].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: FQ212855.1, FQ213419.1 [ECO:0000345]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-11                CK479973.1         1-11
            12-1424             BC082073.1         10-1422
            1425-1442           AI029697.1         1-18                c
FEATURES             Location/Qualifiers
     source          1..1442
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="11"
                     /map="11q23"
     gene            1..1442
                     /gene="Cldn5"
                     /note="claudin 5"
                     /db_xref="GeneID:65131"
                     /db_xref="RGD:68431"
     exon            1..1427
                     /gene="Cldn5"
                     /inference="alignment:Splign:2.1.0"
     CDS             143..799
                     /gene="Cldn5"
                     /codon_start=1
                     /product="claudin-5"
                     /protein_id="NP_113889.1"
                     /db_xref="GeneID:65131"
                     /db_xref="RGD:68431"
                     /translation="
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV"
     misc_feature    155..682
                     /gene="Cldn5"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:304458"
     misc_feature    164..226
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     transmembrane region"
     misc_feature    386..448
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     transmembrane region"
     misc_feature    512..574
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     transmembrane region"
     misc_feature    623..685
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     transmembrane region"
     misc_feature    791..796
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000250"
     STS             143..782
                     /gene="Cldn5"
                     /standard_name="UniSTS:465379"
                     /db_xref="UniSTS:465379"
     STS             1165..1360
                     /gene="Cldn5"
                     /standard_name="RH141529"
                     /db_xref="UniSTS:223523"
ORIGIN      
tgtggttgaaacctctcttctgttccactgcaagaggctccggagcagaggcaccagaatcagcccccaacccacagcccacgcagcgcagagcgcacccggaggccccaagggccatcgggtgagcattcggtctttagccatggggtctgcagcgttggaaattctgggtctggtgctgtgtctggtaggctgggtgggcttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaatatcgtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagcaccgggcacatgcaatgcaaagtgtatgagtctgtgctggcgctgagcgcggaggtgcaggcagctcgggcactcaccgtgggcgctgtgctgctggcgcttgtggcactctttgttaccttgaccggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtggcactcacgggaggagcgctttatgccctgtgtgggcttctggcactggtgccactctgctggttcgccaacatcgtagtccgggagttctatgatccaacggtgccggtgtctcagaagtacgagctgggcgcggcgctgtacatcggctgggcggcctccgcactgctcatgtgtggcggcggcctcgtgtgctgtggcgcctgggtttgcaccgggcgtccagagttcagttttccagtcaagtactcagcaccaaggcgaaccacggccaacggcgattacgacaagaagaactacgtctaagggcgggaggcacggcggggctcttcccgcagctaagcccgcgttcggaaagaccgatgtgggaagccgcgtgtggatgacgaccaccgctgaattgcgcagcgcagactccgaggcaagttaggttgggttcgggccagacttgcgcgctctcacagagaggggtcgttgatcaacgctagccaggccctgctcagaacagactacaggctcttgtgaggacttgaccgaccttttcttctatgcgcagttggccacgacatggtggaactctaagatttcatcggtgaagtagccaccaaactgccgctaacagttcctactgagtcctggggagtgctggatgctgccttaatgtccggtggtacctgctaacctgaaagggcagctggggaaaccctggggctgccagaggaatgcgttaaaaagggcatttttcttgttagtggagaggaacctactgaaccaaaggacttgccctggacctggtctcattccagcagtcccccaaggtgagggggcctgtaggtaccagagccttagaagggttgccttcctcctcgaagcttggggtttggggggtgggccgggtaagactttgcttagtaaatggtttgaacactttcaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]