GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-17 02:35:48, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_031701               1442 bp    mRNA    linear   ROD 18-MAR-2025
DEFINITION  Rattus norvegicus claudin 5 (Cldn5), mRNA.
ACCESSION   NM_031701 XM_344058
VERSION     NM_031701.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1442)
  AUTHORS   Hirose,Y., Oda,Y., Yoshino,K., Yano,F., Kimura,M., Kimura,H.,
            Iyo,M. and Shirayama,Y.
  TITLE     Reduction of claudin-5 and aquaporin-4 in the rat hippocampal CA-1
            and CA-3 regions of a learned helplessness model of depression
  JOURNAL   Pharmacol Biochem Behav 234, 173676 (2024)
   PUBMED   37992974
  REMARK    GeneRIF: Reduction of claudin-5 and aquaporin-4 in the rat
            hippocampal CA-1 and CA-3 regions of a learned helplessness model
            of depression.
REFERENCE   2  (bases 1 to 1442)
  AUTHORS   Hu,Q., Wu,C., Yu,J., Luo,J. and Peng,X.
  TITLE     Angelica sinensis polysaccharide improves rheumatoid arthritis by
            modifying the expression of intestinal Cldn5, Slit3 and Rgs18
            through gut microbiota
  JOURNAL   Int J Biol Macromol 209 (Pt A), 153-161 (2022)
   PUBMED   35318077
  REMARK    GeneRIF: Angelica sinensis polysaccharide improves rheumatoid
            arthritis by modifying the expression of intestinal Cldn5, Slit3
            and Rgs18 through gut microbiota.
REFERENCE   3  (bases 1 to 1442)
  AUTHORS   Andersson,E.A., Rocha-Ferreira,E., Hagberg,H., Mallard,C. and
            Ek,C.J.
  TITLE     Function and Biomarkers of the Blood-Brain Barrier in a Neonatal
            Germinal Matrix Haemorrhage Model
  JOURNAL   Cells 10 (7), 1677 (2021)
   PUBMED   34359845
  REMARK    GeneRIF: Function and Biomarkers of the Blood-Brain Barrier in a
            Neonatal Germinal Matrix Haemorrhage Model.
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1442)
  AUTHORS   Rosas-Martinez,L., Rodriguez-Munoz,R., Namorado-Tonix,M.D.C.,
            Missirlis,F., Del Valle-Mondragon,L., Sanchez-Mendoza,A.,
            Reyes-Sanchez,J.L. and Cervantes-Perez,L.G.
  TITLE     Hyperglycemic levels in early stage of diabetic nephropathy affect
            differentially renal expression of claudins-2 and -5 by oxidative
            stress
  JOURNAL   Life Sci 268, 119003 (2021)
   PUBMED   33417957
  REMARK    GeneRIF: Hyperglycemic levels in early stage of diabetic
            nephropathy affect differentially renal expression of claudins-2
            and -5 by oxidative stress.
REFERENCE   5  (bases 1 to 1442)
  AUTHORS   Shou,J., Peng,J., Zhao,Z., Huang,X., Li,H., Li,L., Gao,X., Xing,Y.
            and Liu,H.
  TITLE     CCL26 and CCR3 are associated with the acute inflammatory response
            in the CNS in experimental autoimmune encephalomyelitis
  JOURNAL   J Neuroimmunol 333, 576967 (2019)
   PUBMED   31151084
  REMARK    GeneRIF: The expression of claudin-5 in the EAE group was
            negatively correlated with the inflammation scores. Levels of CCL26
            in the serum and brain tissues and the number of CCR3-positive
            cells in the brain tissues were negatively correlated with the
            protein expression of claudin-5.
REFERENCE   6  (bases 1 to 1442)
  AUTHORS   Sun,Z.Y., Wei,J., Xie,L., Shen,Y., Liu,S.Z., Ju,G.Z., Shi,J.P.,
            Yu,Y.Q., Zhang,X., Xu,Q. and Hemmings,G.P.
  TITLE     The CLDN5 locus may be involved in the vulnerability to
            schizophrenia
  JOURNAL   Eur Psychiatry 19 (6), 354-357 (2004)
   PUBMED   15363474
REFERENCE   7  (bases 1 to 1442)
  AUTHORS   Wolburg,H., Wolburg-Buchholz,K., Kraus,J., Rascher-Eggstein,G.,
            Liebner,S., Hamm,S., Duffner,F., Grote,E.H., Risau,W. and
            Engelhardt,B.
  TITLE     Localization of claudin-3 in tight junctions of the blood-brain
            barrier is selectively lost during experimental autoimmune
            encephalomyelitis and human glioblastoma multiforme
  JOURNAL   Acta Neuropathol 105 (6), 586-592 (2003)
   PUBMED   12734665
REFERENCE   8  (bases 1 to 1442)
  AUTHORS   Nitta,T., Hata,M., Gotoh,S., Seo,Y., Sasaki,H., Hashimoto,N.,
            Furuse,M. and Tsukita,S.
  TITLE     Size-selective loosening of the blood-brain barrier in
            claudin-5-deficient mice
  JOURNAL   J Cell Biol 161 (3), 653-660 (2003)
   PUBMED   12743111
REFERENCE   9  (bases 1 to 1442)
  AUTHORS   Poliak,S., Matlis,S., Ullmer,C., Scherer,S.S. and Peles,E.
  TITLE     Distinct claudins and associated PDZ proteins form different
            autotypic tight junctions in myelinating Schwann cells
  JOURNAL   J Cell Biol 159 (2), 361-372 (2002)
   PUBMED   12403818
  REMARK    GeneRIF: MUPP1 and claudin-5 colocalized in the incisures, and the
            COOH-terminal region of claudin-5 interacts with MUPP1 in a
            PSD-95/Disc Large/zona occludens (ZO)-1 (PDZ)-dependent manner in
            tight junctions
REFERENCE   10 (bases 1 to 1442)
  AUTHORS   Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S.
  TITLE     Claudin multigene family encoding four-transmembrane domain protein
            components of tight junction strands
  JOURNAL   Proc Natl Acad Sci U S A 96 (2), 511-516 (1999)
   PUBMED   9892664
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CK479973.1, BC082073.1 and AI029697.1.
            
            On Nov 18, 2005 this sequence version replaced NM_031701.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: FQ212855.1, FQ213419.1 [ECO:0000345]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-11                CK479973.1         1-11
            12-1424             BC082073.1         10-1422
            1425-1442           AI029697.1         1-18                c
FEATURES             Location/Qualifiers
     source          1..1442
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="11"
                     /map="11q23"
     gene            1..1442
                     /gene="Cldn5"
                     /note="claudin 5"
                     /db_xref="GeneID:65131"
                     /db_xref="RGD:68431"
     exon            1..1427
                     /gene="Cldn5"
                     /inference="alignment:Splign:2.1.0"
     CDS             143..799
                     /gene="Cldn5"
                     /codon_start=1
                     /product="claudin-5"
                     /protein_id="NP_113889.1"
                     /db_xref="GeneID:65131"
                     /db_xref="RGD:68431"
                     /translation="
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLTGAQCTTCVAPGPVKARVALTGGALYALCGLLALVPLCWFANIVVREFYDPTVPVSQKYELGAALYIGWAASALLMCGGGLVCCGAWVCTGRPEFSFPVKYSAPRRTTANGDYDKKNYV"
     misc_feature    155..682
                     /gene="Cldn5"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
     misc_feature    164..226
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     transmembrane region"
     misc_feature    386..448
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     transmembrane region"
     misc_feature    512..574
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     transmembrane region"
     misc_feature    623..685
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     transmembrane region"
     misc_feature    791..796
                     /gene="Cldn5"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JKD6.2);
                     Region: Interactions with TJP1, TJP2 and TJP3.
                     /evidence=ECO:0000250"
ORIGIN      
tgtggttgaaacctctcttctgttccactgcaagaggctccggagcagaggcaccagaatcagcccccaacccacagcccacgcagcgcagagcgcacccggaggccccaagggccatcgggtgagcattcggtctttagccatggggtctgcagcgttggaaattctgggtctggtgctgtgtctggtaggctgggtgggcttgatcctggcgtgtgggctgcccatgtggcaggtgactgccttcctggaccacaatatcgtgacggcgcagacgacttggaaggggctgtggatgtcgtgcgtggtgcagagcaccgggcacatgcaatgcaaagtgtatgagtctgtgctggcgctgagcgcggaggtgcaggcagctcgggcactcaccgtgggcgctgtgctgctggcgcttgtggcactctttgttaccttgaccggcgctcagtgcaccacctgcgtggccccgggcccagttaaggcacgggtggcactcacgggaggagcgctttatgccctgtgtgggcttctggcactggtgccactctgctggttcgccaacatcgtagtccgggagttctatgatccaacggtgccggtgtctcagaagtacgagctgggcgcggcgctgtacatcggctgggcggcctccgcactgctcatgtgtggcggcggcctcgtgtgctgtggcgcctgggtttgcaccgggcgtccagagttcagttttccagtcaagtactcagcaccaaggcgaaccacggccaacggcgattacgacaagaagaactacgtctaagggcgggaggcacggcggggctcttcccgcagctaagcccgcgttcggaaagaccgatgtgggaagccgcgtgtggatgacgaccaccgctgaattgcgcagcgcagactccgaggcaagttaggttgggttcgggccagacttgcgcgctctcacagagaggggtcgttgatcaacgctagccaggccctgctcagaacagactacaggctcttgtgaggacttgaccgaccttttcttctatgcgcagttggccacgacatggtggaactctaagatttcatcggtgaagtagccaccaaactgccgctaacagttcctactgagtcctggggagtgctggatgctgccttaatgtccggtggtacctgctaacctgaaagggcagctggggaaaccctggggctgccagaggaatgcgttaaaaagggcatttttcttgttagtggagaggaacctactgaaccaaaggacttgccctggacctggtctcattccagcagtcccccaaggtgagggggcctgtaggtaccagagccttagaagggttgccttcctcctcgaagcttggggtttggggggtgggccgggtaagactttgcttagtaaatggtttgaacactttcaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]