GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-17 14:55:16, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_031685               2099 bp    mRNA    linear   ROD 01-FEB-2021
DEFINITION  Rattus norvegicus golgi SNAP receptor complex member 2 (Gosr2),
            mRNA.
ACCESSION   NM_031685
VERSION     NM_031685.2
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 2099)
  AUTHORS   Ghosh D, Lippert D, Krokhin O, Cortens JP and Wilkins JA.
  TITLE     Defining the membrane proteome of NK cells
  JOURNAL   J Mass Spectrom 45 (1), 1-25 (2010)
   PUBMED   19946888
REFERENCE   2  (bases 1 to 2099)
  AUTHORS   Suga K, Hattori H, Saito A and Akagawa K.
  TITLE     RNA interference-mediated silencing of the syntaxin 5 gene induces
            Golgi fragmentation but capable of transporting vesicles
  JOURNAL   FEBS Lett 579 (20), 4226-4234 (2005)
   PUBMED   16081076
REFERENCE   3  (bases 1 to 2099)
  AUTHORS   Peng J, Huang CH, Short MK and Jubinsky PT.
  TITLE     Magmas gene structure and evolution
  JOURNAL   In Silico Biol 5 (3), 251-263 (2005)
   PUBMED   15984936
REFERENCE   4  (bases 1 to 2099)
  AUTHORS   Zhang T and Hong W.
  TITLE     Ykt6 forms a SNARE complex with syntaxin 5, GS28, and Bet1 and
            participates in a late stage in endoplasmic reticulum-Golgi
            transport
  JOURNAL   J Biol Chem 276 (29), 27480-27487 (2001)
   PUBMED   11323436
REFERENCE   5  (bases 1 to 2099)
  AUTHORS   Lowe SL, Peter F, Subramaniam VN, Wong SH and Hong W.
  TITLE     A SNARE involved in protein transport through the Golgi apparatus
  JOURNAL   Nature 389 (6653), 881-884 (1997)
   PUBMED   9349823
REFERENCE   6  (bases 1 to 2099)
  AUTHORS   Hay JC, Chao DS, Kuo CS and Scheller RH.
  TITLE     Protein interactions regulating vesicle transport between the
            endoplasmic reticulum and Golgi apparatus in mammalian cells
  JOURNAL   Cell 89 (1), 149-158 (1997)
   PUBMED   9094723
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC061994.1.
            On Jan 1, 2004 this sequence version replaced NM_031685.1.
            
            Summary: may play a role in vesicle transport from the cis/medial
            to the trans-Golgi/TGN [RGD, Feb 2006].
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC061994.1, CO573750.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2099
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="10"
                     /map="10q32.1"
     gene            1..2099
                     /gene="Gosr2"
                     /note="golgi SNAP receptor complex member 2"
                     /db_xref="GeneID:64154"
                     /db_xref="RGD:62079"
     exon            1..42
                     /gene="Gosr2"
                     /inference="alignment:Splign:2.0.8"
     misc_feature    2..4
                     /gene="Gosr2"
                     /note="upstream in-frame stop codon"
     CDS             14..652
                     /gene="Gosr2"
                     /note="membrin; 27 kDa Golgi SNARE protein"
                     /codon_start=1
                     /product="Golgi SNAP receptor complex member 2"
                     /protein_id="NP_113873.1"
                     /db_xref="GeneID:64154"
                     /db_xref="RGD:62079"
                     /translation="
MEPLYQQTHKQVHEIQSHMGRLETADKQSVHLVENEIQASIDQIFSHLERLEILSSKEPPNRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQAKEQQERQRDELLSRTFTTNDSDTTIPMDESLQFNSSLQNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCAVMFLVVQYLT"
     misc_feature    14..16
                     /gene="Gosr2"
                     /note="N-acetylmethionine.
                     /evidence=ECO:0000250|UniProtKB:O14653; propagated from
                     UniProtKB/Swiss-Prot (O35165.2); acetylation site"
     misc_feature    365..373
                     /gene="Gosr2"
                     /note="propagated from UniProtKB/Swiss-Prot (O35165.2);
                     Region: IxM motif, signal for cargo packaging into
                     COPII-coated vesicles.
                     /evidence=ECO:0000250|UniProtKB:O14653"
     misc_feature    371..568
                     /gene="Gosr2"
                     /note="SNARE motif of GS27; Region: SNARE_GS27; cd15863"
                     /db_xref="CDD:277216"
     misc_feature    order(386..394,398..415,419..424,431..436,440..457,
                     461..466,470..478,482..499,503..508,512..520,524..529,
                     533..541,545..550,554..556)
                     /gene="Gosr2"
                     /note="heterotetramer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:277216"
     misc_feature    473..475
                     /gene="Gosr2"
                     /note="zero layer; other site"
                     /db_xref="CDD:277216"
     misc_feature    584..646
                     /gene="Gosr2"
                     /note="propagated from UniProtKB/Swiss-Prot (O35165.2);
                     transmembrane region"
     exon            43..107
                     /gene="Gosr2"
                     /inference="alignment:Splign:2.0.8"
     exon            108..216
                     /gene="Gosr2"
                     /inference="alignment:Splign:2.0.8"
     exon            217..349
                     /gene="Gosr2"
                     /inference="alignment:Splign:2.0.8"
     exon            350..490
                     /gene="Gosr2"
                     /inference="alignment:Splign:2.0.8"
     exon            491..2075
                     /gene="Gosr2"
                     /inference="alignment:Splign:2.0.8"
ORIGIN      
ctaggccggcatcatggagccactataccaacaaacgcacaagcaggtccacgagatccagtctcacatgggacgcctggagacggcagacaagcagtctgtgcacttagtggaaaatgaaatccaagcaagcatagaccagatattcagccacctggagcgtctggagattctgtcaagcaaggagccccccaatagaaggcagaacgccaaacttcgtgtcgaccagctaaagtacgacgtccagcacttgcagactgccctcaggaactttcagcaccggcgccaagccaaggagcagcaggagagacagcgagatgagcttctgtctcgcaccttcaccactaacgactctgacaccaccattcccatggatgaatcactgcagtttaactcctccctccagaacattcaccacggcatggatgacctcattggaggcgggcacagtattctggagggactgagggcccagagactgaccttgaaggggactcagaaaaagatcctcgacattgccaacatgctcggcttgtccaacaccgtgatgaggctgattgagaagcgggccttccaggacaagtacttcatgatcggtgggatgctgctcacttgtgcagttatgtttctcgtggtgcagtacctgacatgagccagctgtacccagcactggacagccttcccattgtgtgcgcatgtgcaagcaagaagtgggctgggaggcccttttgaaatgtatgccttaactgtgaagacacctctccctccaggactaatcgtggcttagtatcaaacctgctttgttttctgtgacatctggggagtaggacctagggtcaccaagatgtgtggtacttaggaggtggttcaagaccctgttctctggctttcacgggggtggggtggggtggggagggatggctaggttttgtggtttgtccacacagctgatgcagaggaaagtgtgcattatgaggcctgcacacaggactgtccactctgttcacttctggtcatcaccagcttttgtggctcctgagaggtgggctggagcacagtgagatgaggaaagaggtctttccttacaccatctgggatggatcagttctcacatccttgcttctagccactactcggccccagcccctaagaaaacaggacatgtaggtgactaaccacgaacaccagcaccctttcctggaagcagctactccagggaagcagagacatcagtgctgctgctgataatgtaagcgtttccgtgccacggttgctgggtgtttgtccttcctgaagtgaggctagcagtgttcccagggagtgtttagtctggaccctgaagtcctgagtcaccaggacttgatacagcaattggctcttgcagttcggagacagtggctcagcacctccacccaggctctgatcttgggcctttaaaaggagccatgagcaaagggtgacttgtcagttacagattcatctaattctgccatctcagatcctttgactatctctcccttgaaatacattagcaatatatcaatcagctaagcctccattttccccagccctcgtaggccaccctggaggtgtccctggtaagaatgtttttgtgagactgtttcagggaccaggtcattctcacttgtcccagacgtgattaaggctatgtcagtacctggtgtattgcagaatttgtttgaaagttaatgtatctcaagcacacctattgtgattaatcttcgcaagtactagaacggtccagtgagtttatttgttcatcagtaacgagccctgcccacccaaacagttctaaatttagtagcctcctggtgggaaaaacagatgccaggattcctaagaactggaaactggtcagtattaatccttcctctgattgccccacctacttcctgtgtttgcttaagtcctgtgcttttccctcctcacagtgcactatgtctcaccctcctactgagttgcagtactcctctctcccatacgtctgtggcatcctgtccacatctgtggcatccttttgggaactgtctcaattgaacacattttaaacctgaaaaaaaaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]