GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-11 14:33:36, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_024350               1518 bp    mRNA    linear   ROD 27-MAR-2024
DEFINITION  Rattus norvegicus homeo box A4 (Hoxa4), mRNA.
ACCESSION   NM_024350
VERSION     NM_024350.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1518)
  AUTHORS   Zhao,Y. and Potter,S.S.
  TITLE     Functional comparison of the Hoxa 4, Hoxa 10, and Hoxa 11
            homeoboxes
  JOURNAL   Dev Biol 244 (1), 21-36 (2002)
   PUBMED   11900456
REFERENCE   2  (bases 1 to 1518)
  AUTHORS   Horan,G.S., Ramirez-Solis,R., Featherstone,M.S., Wolgemuth,D.J.,
            Bradley,A. and Behringer,R.R.
  TITLE     Compound mutants for the paralogous hoxa-4, hoxb-4, and hoxd-4
            genes show more complete homeotic transformations and a
            dose-dependent increase in the number of vertebrae transformed
  JOURNAL   Genes Dev 9 (13), 1667-1677 (1995)
   PUBMED   7628700
REFERENCE   3  (bases 1 to 1518)
  AUTHORS   Sakoyama,Y., Mizuta,I., Ogasawara,N. and Yoshikawa,H.
  TITLE     Cloning of rat homeobox genes
  JOURNAL   Biochem Genet 32 (9-10), 351-360 (1994)
   PUBMED   7702549
REFERENCE   4  (bases 1 to 1518)
  AUTHORS   Kostic,D. and Capecchi,M.R.
  TITLE     Targeted disruptions of the murine Hoxa-4 and Hoxa-6 genes result
            in homeotic transformations of components of the vertebral column
  JOURNAL   Mech Dev 46 (3), 231-247 (1994)
   PUBMED   7918106
REFERENCE   5  (bases 1 to 1518)
  AUTHORS   Gorski,D.H., LePage,D.F. and Walsh,K.
  TITLE     Cloning and sequence analysis of homeobox transcription factor
            cDNAs with an inosine-containing probe
  JOURNAL   Biotechniques 16 (5), 856-858 (1994)
   PUBMED   7915120
REFERENCE   6  (bases 1 to 1518)
  AUTHORS   Chung,S.Y., Dai,P.H., Lei,J., Riviere,M., Levan,G., Szpirer,J. and
            Szpirer,C.
  TITLE     Chromosomal assignment of seven rat homeobox genes to rat
            chromosomes 3, 4, 7, and 10
  JOURNAL   Mamm Genome 4 (9), 537-540 (1993)
   PUBMED   7906969
REFERENCE   7  (bases 1 to 1518)
  AUTHORS   Falzon,M., Sanderson,N. and Chung,S.Y.
  TITLE     Cloning and expression of rat homeo-box-containing sequences
  JOURNAL   Gene 54 (1), 23-32 (1987)
   PUBMED   2886401
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAXUCZ010000004.1.
            
            Summary: The protein encoded by this gene is likely a homeobox
            transcription factor. [provided by RefSeq, Sep 2015].
            
            Sequence Note: This RefSeq record was created genomic sequence data
            to make the sequence consistent with the reference genome assembly.
            The genomic coordinates used for the transcript record were based
            on transcript alignments and orthologous data.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CK366967.1, SRR26360181.635342.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN16676786 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-515               JAXUCZ010000004.1  82621788-82622302   c
            516-1518            JAXUCZ010000004.1  82620294-82621296   c
FEATURES             Location/Qualifiers
     source          1..1518
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="BN"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q24"
     gene            1..1518
                     /gene="Hoxa4"
                     /gene_synonym="hox1.4; Hox1r2"
                     /note="homeo box A4"
                     /db_xref="GeneID:100912525"
                     /db_xref="RGD:2814"
     exon            1..515
                     /gene="Hoxa4"
                     /gene_synonym="hox1.4; Hox1r2"
                     /inference="alignment:Splign:2.1.0"
     CDS             5..862
                     /gene="Hoxa4"
                     /gene_synonym="hox1.4; Hox1r2"
                     /note="homeobox protein Hox-A4-like; Homeobox gene A4;
                     homeobox protein R2; homeobox A4-like"
                     /codon_start=1
                     /product="homeobox protein Hox-A4"
                     /protein_id="NP_077326.1"
                     /db_xref="GeneID:100912525"
                     /db_xref="RGD:2814"
                     /translation="
MTMSSFLINSNYIEPKFPPFEEFAPHGGPGGGDGGVGGGPGYPRPQSSPHLPAPNPHAARQTPAYYAPRAREPSYHGGLYPAPAAACPYACRGASPARPEQSPAPGAHPSPAPQPPAPPRRCAPGPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNPASAPAGPPGKAQTHSPHPHPHPLPGASTPIPSSI"
     misc_feature    545..715
                     /gene="Hoxa4"
                     /gene_synonym="hox1.4; Hox1r2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            516..1518
                     /gene="Hoxa4"
                     /gene_synonym="hox1.4; Hox1r2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
attaatgaccatgagctcgtttttgataaactccaactacatcgagcccaagttccctcccttcgaggagttcgcaccgcacggtggcccgggcggtggggacggcggcgtgggcgggggtcccggctacccgcggcctcagagctccccgcacctgccggccccgaacccgcacgcggcccgacagacccccgcatactacgcgccaagggcgcgcgagcccagctaccacgggggcctgtaccccgcgcccgccgccgcctgtccctacgcctgtcgcggggccagccccgcgcgacccgagcagtccccggcccccggcgcgcatcccagcccggccccgcagccccctgcgccccctcggcgctgcgctccgggccccaccaccccggctgtcgcgacggggggcagcgcccccgcgtgcccgctgctgctggcggaccagggccccgcgggcccgaagggcaaggagccggtggtgtacccctggatgaagaagatccacgtgagcgccgtcaaccccagttataacggaggtgagcccaagcgctctcgaaccgcctatacccggcagcaagtcttggagctggagaaggaattccactttaaccgatacctgacccggcgccgccgcatcgagatcgctcacacgctctgcttgtccgagcgccaggtcaagatctggttccagaaccggagaatgaagtggaagaaagaccacaaacttcccaacaccaagatgcgatcttccaaccctgcctcggcccctgccggcccgcctgggaaagcacaaactcacagcccacacccccatccccaccctctccccggtgcttccacacccattccctcgtctatataatctagagacctagatcagtttctgtcacttatgtgcccaactcatctcctgctcctgtcctcgtctgctccttcctaagtaaacctgagacaccaaaacaaaatccaacttgctggaaatcataaccaaaaagaagatattattcctggttggtgtctgtgtgtgacccccccaagaggacatctgtcctggttactgcttagtggaacaacctgctgacctggacaactttgccagggttggacacctgtaaggaagcactggtcatcgactacctttgagtccaccagacagcacgtgctgactggggacatgtatgtttgttgcaagcagaagaagcaggcagttccccagcttccttacctttctcttctgcattaaggcagctcacatgagctttactgagtagacattgtggacctcaccagattatttaattctcaaagtgtgtagaccttgatggtaggtgtggcatgtagtttcctctccttgcatttatttaagatactgttatagagatattgttgtcttattctggggcacagtcttggggagagggaaatgcatttagacccacttgcaactgtacagagcgatatggttgtataaagaggaatgtgctaagaataaacttcaatttataagacatttaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]