2025-07-11 16:13:47, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_024350 1518 bp mRNA linear ROD 27-MAR-2024 DEFINITION Rattus norvegicus homeo box A4 (Hoxa4), mRNA. ACCESSION NM_024350 VERSION NM_024350.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1518) AUTHORS Zhao,Y. and Potter,S.S. TITLE Functional comparison of the Hoxa 4, Hoxa 10, and Hoxa 11 homeoboxes JOURNAL Dev Biol 244 (1), 21-36 (2002) PUBMED 11900456 REFERENCE 2 (bases 1 to 1518) AUTHORS Horan,G.S., Ramirez-Solis,R., Featherstone,M.S., Wolgemuth,D.J., Bradley,A. and Behringer,R.R. TITLE Compound mutants for the paralogous hoxa-4, hoxb-4, and hoxd-4 genes show more complete homeotic transformations and a dose-dependent increase in the number of vertebrae transformed JOURNAL Genes Dev 9 (13), 1667-1677 (1995) PUBMED 7628700 REFERENCE 3 (bases 1 to 1518) AUTHORS Sakoyama,Y., Mizuta,I., Ogasawara,N. and Yoshikawa,H. TITLE Cloning of rat homeobox genes JOURNAL Biochem Genet 32 (9-10), 351-360 (1994) PUBMED 7702549 REFERENCE 4 (bases 1 to 1518) AUTHORS Kostic,D. and Capecchi,M.R. TITLE Targeted disruptions of the murine Hoxa-4 and Hoxa-6 genes result in homeotic transformations of components of the vertebral column JOURNAL Mech Dev 46 (3), 231-247 (1994) PUBMED 7918106 REFERENCE 5 (bases 1 to 1518) AUTHORS Gorski,D.H., LePage,D.F. and Walsh,K. TITLE Cloning and sequence analysis of homeobox transcription factor cDNAs with an inosine-containing probe JOURNAL Biotechniques 16 (5), 856-858 (1994) PUBMED 7915120 REFERENCE 6 (bases 1 to 1518) AUTHORS Chung,S.Y., Dai,P.H., Lei,J., Riviere,M., Levan,G., Szpirer,J. and Szpirer,C. TITLE Chromosomal assignment of seven rat homeobox genes to rat chromosomes 3, 4, 7, and 10 JOURNAL Mamm Genome 4 (9), 537-540 (1993) PUBMED 7906969 REFERENCE 7 (bases 1 to 1518) AUTHORS Falzon,M., Sanderson,N. and Chung,S.Y. TITLE Cloning and expression of rat homeo-box-containing sequences JOURNAL Gene 54 (1), 23-32 (1987) PUBMED 2886401 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAXUCZ010000004.1. Summary: The protein encoded by this gene is likely a homeobox transcription factor. [provided by RefSeq, Sep 2015]. Sequence Note: This RefSeq record was created genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments and orthologous data. ##Evidence-Data-START## Transcript exon combination :: CK366967.1, SRR26360181.635342.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN16676786 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-515 JAXUCZ010000004.1 82621788-82622302 c 516-1518 JAXUCZ010000004.1 82620294-82621296 c FEATURES Location/Qualifiers source 1..1518 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="4" /map="4q24" gene 1..1518 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="
MTMSSFLINSNYIEPKFPPFEEFAPHGGPGGGDGGVGGGPGYPRPQSSPHLPAPNPHAARQTPAYYAPRAREPSYHGGLYPAPAAACPYACRGASPARPEQSPAPGAHPSPAPQPPAPPRRCAPGPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNPASAPAGPPGKAQTHSPHPHPHPLPGASTPIPSSI"
misc_feature 545..715 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 516..1518 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" ORIGIN
attaatgaccatgagctcgtttttgataaactccaactacatcgagcccaagttccctcccttcgaggagttcgcaccgcacggtggcccgggcggtggggacggcggcgtgggcgggggtcccggctacccgcggcctcagagctccccgcacctgccggccccgaacccgcacgcggcccgacagacccccgcatactacgcgccaagggcgcgcgagcccagctaccacgggggcctgtaccccgcgcccgccgccgcctgtccctacgcctgtcgcggggccagccccgcgcgacccgagcagtccccggcccccggcgcgcatcccagcccggccccgcagccccctgcgccccctcggcgctgcgctccgggccccaccaccccggctgtcgcgacggggggcagcgcccccgcgtgcccgctgctgctggcggaccagggccccgcgggcccgaagggcaaggagccggtggtgtacccctggatgaagaagatccacgtgagcgccgtcaaccccagttataacggaggtgagcccaagcgctctcgaaccgcctatacccggcagcaagtcttggagctggagaaggaattccactttaaccgatacctgacccggcgccgccgcatcgagatcgctcacacgctctgcttgtccgagcgccaggtcaagatctggttccagaaccggagaatgaagtggaagaaagaccacaaacttcccaacaccaagatgcgatcttccaaccctgcctcggcccctgccggcccgcctgggaaagcacaaactcacagcccacacccccatccccaccctctccccggtgcttccacacccattccctcgtctatataatctagagacctagatcagtttctgtcacttatgtgcccaactcatctcctgctcctgtcctcgtctgctccttcctaagtaaacctgagacaccaaaacaaaatccaacttgctggaaatcataaccaaaaagaagatattattcctggttggtgtctgtgtgtgacccccccaagaggacatctgtcctggttactgcttagtggaacaacctgctgacctggacaactttgccagggttggacacctgtaaggaagcactggtcatcgactacctttgagtccaccagacagcacgtgctgactggggacatgtatgtttgttgcaagcagaagaagcaggcagttccccagcttccttacctttctcttctgcattaaggcagctcacatgagctttactgagtagacattgtggacctcaccagattatttaattctcaaagtgtgtagaccttgatggtaggtgtggcatgtagtttcctctccttgcatttatttaagatactgttatagagatattgttgtcttattctggggcacagtcttggggagagggaaatgcatttagacccacttgcaactgtacagagcgatatggttgtataaagaggaatgtgctaagaataaacttcaatttataagacatttaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]