GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2021-10-29 03:20:45, GGRNA.v2 : RefSeq release 207 (Jul, 2021)

LOCUS       NM_022637                879 bp    mRNA    linear   ROD 21-JUN-2021
DEFINITION  Rattus norvegicus ventral anterior homeobox 2 (Vax2), mRNA.
ACCESSION   NM_022637
VERSION     NM_022637.1
KEYWORDS    RefSeq.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 879)
  AUTHORS   Vacik T, Stubbs JL and Lemke G.
  TITLE     A novel mechanism for the transcriptional regulation of Wnt
            signaling in development
  JOURNAL   Genes Dev 25 (17), 1783-1795 (2011)
   PUBMED   21856776
REFERENCE   2  (bases 1 to 879)
  AUTHORS   Kim JW and Lemke G.
  TITLE     Hedgehog-regulated localization of Vax2 controls eye development
  JOURNAL   Genes Dev 20 (20), 2833-2847 (2006)
   PUBMED   17043310
REFERENCE   3  (bases 1 to 879)
  AUTHORS   Mui SH, Kim JW, Lemke G and Bertuzzi S.
  TITLE     Vax genes ventralize the embryonic eye
  JOURNAL   Genes Dev 19 (10), 1249-1259 (2005)
   PUBMED   15905411
REFERENCE   4  (bases 1 to 879)
  AUTHORS   Barbieri AM, Broccoli V, Bovolenta P, Alfano G, Marchitiello A,
            Mocchetti C, Crippa L, Bulfone A, Marigo V, Ballabio A and Banfi S.
  TITLE     Vax2 inactivation in mouse determines alteration of the eye
            dorsal-ventral axis, misrouting of the optic fibres and eye
            coloboma
  JOURNAL   Development 129 (3), 805-813 (2002)
   PUBMED   11830579
REFERENCE   5  (bases 1 to 879)
  AUTHORS   Mui SH, Hindges R, O'Leary DD, Lemke G and Bertuzzi S.
  TITLE     The homeodomain protein Vax2 patterns the dorsoventral and
            nasotemporal axes of the eye
  JOURNAL   Development 129 (3), 797-804 (2002)
   PUBMED   11830578
REFERENCE   6  (bases 1 to 879)
  AUTHORS   Schulte D, Furukawa T, Peters MA, Kozak CA and Cepko CL.
  TITLE     Misexpression of the Emx-related homeobox genes cVax and mVax2
            ventralizes the retina and perturbs the retinotectal map
  JOURNAL   Neuron 24 (3), 541-553 (1999)
   PUBMED   10595508
REFERENCE   7  (bases 1 to 879)
  AUTHORS   Barbieri AM, Lupo G, Bulfone A, Andreazzoli M, Mariani M,
            Fougerousse F, Consalez GG, Borsani G, Beckmann JS, Barsacchi G,
            Ballabio A and Banfi S.
  TITLE     A homeobox gene, vax2, controls the patterning of the eye
            dorsoventral axis
  JOURNAL   Proc Natl Acad Sci U S A 96 (19), 10729-10734 (1999)
   PUBMED   10485894
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF113516.1.
            
            Summary: mouse homolog is a transcription factor involved in
            development of the ventral optic vesicle [RGD, Feb 2006].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF113516.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760476, SAMN11044071
                                           [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..879
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q34"
     gene            1..879
                     /gene="Vax2"
                     /note="ventral anterior homeobox 2"
                     /db_xref="GeneID:64572"
                     /db_xref="RGD:621133"
     CDS             1..879
                     /gene="Vax2"
                     /note="ventral anterior homeobox containing gene 2"
                     /codon_start=1
                     /product="ventral anterior homeobox 2"
                     /protein_id="NP_072159.1"
                     /db_xref="GeneID:64572"
                     /db_xref="RGD:621133"
                     /translation="
MGDGGAERDRGPKRREEPGGRSGCRGEHRGAEDLRADTGSTSPREIAGTSASSPAGSRESGGDSDGQQALGETDHCRRILVRDAKGTIREIVLPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQSRDLEKRASSSAFEAFATSNVLRLLEQGRLLSVPRAPSLLALSPGLPGLTAGHRGTSLGDPRNSSQRLNPMPSASASSPLPPPLPAVCFSAAPLLDLPASYKLGSSAFEPYSRLEQQKVGSPGQSDKKADI"
     misc_feature    220..303
                     /gene="Vax2"
                     /note="Region: vax upstream domain"
     misc_feature    304..483
                     /gene="Vax2"
                     /note="Region: homeobox"
     misc_feature    order(307..321,325..327,376..378,394..396,433..435,
                     439..444,451..456,460..468,472..477)
                     /gene="Vax2"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    313..474
                     /gene="Vax2"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(313..315,322..324,442..444,451..456,463..465)
                     /gene="Vax2"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    544..579
                     /gene="Vax2"
                     /note="Region: vax downstream domain"
     misc_feature    634..723
                     /gene="Vax2"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9JLZ9.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    796..822
                     /gene="Vax2"
                     /note="Region: vax terminal domain"
     exon            1..247
                     /gene="Vax2"
                     /inference="alignment:Splign:2.1.0"
     STS             116..502
                     /gene="Vax2"
                     /standard_name="Vax2"
                     /db_xref="UniSTS:527039"
     exon            248..435
                     /gene="Vax2"
                     /inference="alignment:Splign:2.1.0"
     exon            436..879
                     /gene="Vax2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
atgggcgatgggggcgcggagcgggaccgcggccccaagcgccgggaggagcctggtggccgcagcgggtgtcgtggggagcaccgcggagcggaagatttgcgtgctgacacgggtagcacgagtccgagggagattgctgggacctccgcctccagccctgcaggctccagggagagcggcggggacagcgacggacaacaggcgctcggtgagacggaccactgccgccgcatcctggtacgagatgccaaggggaccattcgggaaattgtcctgcccaagggcctggacctcgaccgacccaagaggacccgtacctccttcacagcagaacagctgtatcgtttggagatggagttccagcgctgccagtatgtggtgggccgagagcgcacagagctggcccgccagctgaacctctctgagactcaggtgaaggtctggttccagaaccgccgcaccaagcagaagaaggaccagagcagagacctggaaaagcgggcatcctcctccgccttcgaggcctttgccacctccaacgttctgcgacttctggaacagggccggctgctctccgtgcccagagctcccagcctcctagcactgagccctggcctgccaggtctaaccgctggccacaggggcacctccttgggtgaccccaggaactcctcccaacgcctcaatccaatgccctcagcctcagcgtcgtcccctctgccaccccctctgccagccgtctgcttttccgcagctccactcctggacttgcccgccagctacaaactggggtcctcggcttttgagccctacagcagactagaacaacagaaagtaggcagccctggccaaagtgacaagaaagctgacatttaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]