2025-09-18 10:42:28, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_022636 1011 bp mRNA linear ROD 02-APR-2025 DEFINITION Rattus norvegicus ventral anterior homeobox 1 (Vax1), mRNA. ACCESSION NM_022636 VERSION NM_022636.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1011) AUTHORS Rajan,S., Chu Pham Dang,H., Djambazian,H., Zuzan,H., Fedyshyn,Y., Ketela,T., Moffat,J., Hudson,T.J. and Sladek,R. TITLE Analysis of early C2C12 myogenesis identifies stably and differentially expressed transcriptional regulators whose knock-down inhibits myoblast differentiation JOURNAL Physiol Genomics 44 (2), 183-197 (2012) PUBMED 22147266 REFERENCE 2 (bases 1 to 1011) AUTHORS Kim,J.W. and Lemke,G. TITLE Hedgehog-regulated localization of Vax2 controls eye development JOURNAL Genes Dev 20 (20), 2833-2847 (2006) PUBMED 17043310 REFERENCE 3 (bases 1 to 1011) AUTHORS Mui,S.H., Kim,J.W., Lemke,G. and Bertuzzi,S. TITLE Vax genes ventralize the embryonic eye JOURNAL Genes Dev 19 (10), 1249-1259 (2005) PUBMED 15905411 REFERENCE 4 (bases 1 to 1011) AUTHORS Soria,J.M., Taglialatela,P., Gil-Perotin,S., Galli,R., Gritti,A., Verdugo,J.M. and Bertuzzi,S. TITLE Defective postnatal neurogenesis and disorganization of the rostral migratory stream in absence of the Vax1 homeobox gene JOURNAL J Neurosci 24 (49), 11171-11181 (2004) PUBMED 15590934 REFERENCE 5 (bases 1 to 1011) AUTHORS Taglialatela,P., Soria,J.M., Caironi,V., Moiana,A. and Bertuzzi,S. TITLE Compromised generation of GABAergic interneurons in the brains of Vax1-/- mice JOURNAL Development 131 (17), 4239-4249 (2004) PUBMED 15280216 REFERENCE 6 (bases 1 to 1011) AUTHORS Hallonet,M., Hollemann,T., Pieler,T. and Gruss,P. TITLE Vax1, a novel homeobox-containing gene, directs development of the basal forebrain and visual system JOURNAL Genes Dev 13 (23), 3106-3114 (1999) PUBMED 10601036 REFERENCE 7 (bases 1 to 1011) AUTHORS Bertuzzi,S., Hindges,R., Mui,S.H., O'Leary,D.D. and Lemke,G. TITLE The homeodomain protein vax1 is required for axon guidance and major tract formation in the developing forebrain JOURNAL Genes Dev 13 (23), 3092-3105 (1999) PUBMED 10601035 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from AF113515.1. ##Evidence-Data-START## Transcript exon combination :: AF113515.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760383, SAMEA5760389 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1011 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="1" /map="1q55" gene 1..1011 /gene="Vax1" /note="ventral anterior homeobox 1" /db_xref="GeneID:64571" /db_xref="RGD:621132" CDS 1..1011 /gene="Vax1" /note="ventral anterior homeobox containing gene 1" /codon_start=1 /product="ventral anterior homeobox 1" /protein_id="NP_072158.1" /db_xref="GeneID:64571" /db_xref="RGD:621132" /translation="
MFGKTDKMDVRCHSDTEAARVSKNAHKESREIKGAEGSLPAAFLKEPQGAFSASGASEDCNKSKSNSSADPDYCRRILVRDAKGSIREIILPKGLDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQGKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATGALGSALRGPSLPALGAGAAAGSAAAAAAAATAPGPAGAASQHPPAVGGAPGPGPAGPGGLHAGAPTASHGLFSLPVPSLLGSVASRLSSAPLTMAGSLAGNLQELSARYLSSSAFEPYSRTNNKEGAEKKALD"
misc_feature 1..117 /gene="Vax1" /note="propagated from UniProtKB/Swiss-Prot (Q9JM00.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 148..207 /gene="Vax1" /note="propagated from UniProtKB/Swiss-Prot (Q9JM00.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 214..297 /gene="Vax1" /note="Region: vax upstream domain" misc_feature 298..477 /gene="Vax1" /note="Region: homeobox" misc_feature 301..471 /gene="Vax1" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" misc_feature 532..567 /gene="Vax1" /note="Region: vax downstream domain" misc_feature 706..801 /gene="Vax1" /note="propagated from UniProtKB/Swiss-Prot (Q9JM00.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" misc_feature 943..969 /gene="Vax1" /note="Region: vax terminal domain" exon 1..241 /gene="Vax1" /inference="alignment:Splign:2.1.0" exon 242..429 /gene="Vax1" /inference="alignment:Splign:2.1.0" exon 430..1011 /gene="Vax1" /inference="alignment:Splign:2.1.0" ORIGIN
atgttcgggaaaacagacaaaatggacgtccggtgccactcggacaccgaggccgccagggtatcgaagaacgcgcacaaggagagccgagagatcaagggcgccgaggggagccttccggctgccttcctcaaggagccgcagggcgccttttcggcgtctggcgcttccgaagattgtaacaaaagtaaatccaattcctcagcagacccagattactgccgccggatcctagtccgagatgccaaggggtctatccgagaaatcatcctgcccaagggcttggacctggaccggcccaagaggacacgcacgtccttcaccgcggagcagctctacagactggagatggagttccagcgttgccaatatgtagtgggccgggagagaaccgagctggctcggcagctcaatctttctgaaacccaggtgaaggtctggttccagaatcggcggaccaagcagaagaaggaccagggtaaagactcggagctgcgctcggtggtgtcggagaccgccgccacgtgcagcgtgctgcggctgttggagcaaggccgcctgttgtcgcctcccgggctgcccgccttgctgccgccctgtgctacaggcgctctgggctccgcgttgcgcgggcccagcctcccggccctgggtgcaggcgctgctgcgggctccgccgctgctgccgccgccgccgccactgccccgggtccggccggcgcggcgtcccagcatccgccagccgtgggcggcgctcccggccccgggcctgcagggcccgggggactgcacgcgggagctccgacagccagccacggtctcttcagcctgccggtgccgtcgctgctaggctctgtcgccagccgcctgtcctccgccccgttgacgatggctggttcgctagccgggaatttgcaagaactctcagcccgttacctgagctcctcggccttcgagccttactcccggaccaacaataaagaaggggccgagaaaaaagcgctggactga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]