GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-03-31 05:37:00, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_021728               3011 bp    mRNA    linear   PRI 21-JAN-2020
DEFINITION  Homo sapiens orthodenticle homeobox 2 (OTX2), transcript variant 1,
            mRNA.
ACCESSION   NM_021728
VERSION     NM_021728.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3011)
  AUTHORS   Figueira Muoio VM, Uno M, Oba-Shinjo S, da Silva R, Araujo Pereira
            BJ, Clara C, Matushita H and Marie SNK.
  TITLE     OTX1 and OTX2 Genes in Medulloblastoma
  JOURNAL   World Neurosurg 127, e58-e64 (2019)
   PUBMED   30797919
  REMARK    GeneRIF: The OTX2 gene was expressed in 62% of 60 Brazilian
            medulloblastoma patients. Expression varied with age (higher in
            younger age groups), location (predominantly vermis), and
            histological type (classic and anaplastic). A statistical
            correlation between OTX2 gene expression and the development of
            leptomeningeal metastases was observed.
            Erratum:[World Neurosurg. 2019 Oct;130:377. PMID: 31421436]
REFERENCE   2  (bases 1 to 3011)
  AUTHORS   Sakai A and Sugiyama S.
  TITLE     Experience-dependent transcriptional regulation in juvenile brain
            development
  JOURNAL   Dev. Growth Differ. 60 (8), 473-482 (2018)
   PUBMED   30368782
  REMARK    GeneRIF: It identified downstream targets of Otx2 suggest novel
            roles of Otx2 in homeostasis of PV cells, and, moreover, in
            regulation of chromatin state, which is important for neuronal
            plasticity.
            Review article
REFERENCE   3  (bases 1 to 3011)
  AUTHORS   Kaufman J, Wymbs NF, Montalvo-Ortiz JL, Orr C, Albaugh MD, Althoff
            R, O'Loughlin K, Holbrook H, Garavan H, Kearney C, Yang BZ, Zhao H,
            Pena C, Nestler EJ, Lee RS, Mostofsky S, Gelernter J and Hudziak J.
  TITLE     Methylation in OTX2 and related genes, maltreatment, and depression
            in children
  JOURNAL   Neuropsychopharmacology 43 (11), 2204-2211 (2018)
   PUBMED   30089883
  REMARK    GeneRIF: Maltreatment history and DNA methylation in OTX2
            significantly predicted depression in children.
REFERENCE   4  (bases 1 to 3011)
  AUTHORS   Su Z, Zhang Y, Liao B, Zhong X, Chen X, Wang H, Guo Y, Shan Y, Wang
            L and Pan G.
  TITLE     Antagonism between the transcription factors NANOG and OTX2
            specifies rostral or caudal cell fate during neural patterning
            transition
  JOURNAL   J. Biol. Chem. 293 (12), 4445-4455 (2018)
   PUBMED   29386354
  REMARK    GeneRIF: have uncovered a mutual antagonism between NANOG and OTX2
            underlying cell fate decisions during neural patterning, critical
            for the regulation of early neural development in humans
REFERENCE   5  (bases 1 to 3011)
  AUTHORS   Fong SL and Fong WB.
  TITLE     Elements regulating the transcription of human interstitial
            retinoid-binding protein (IRBP) gene in cultured retinoblastoma
            cells
  JOURNAL   Curr. Eye Res. 18 (4), 283-291 (1999)
   PUBMED   10372988
REFERENCE   6  (bases 1 to 3011)
  AUTHORS   Bobola N, Briata P, Ilengo C, Rosatto N, Craft C, Corte G and
            Ravazzolo R.
  TITLE     OTX2 homeodomain protein binds a DNA element necessary for
            interphotoreceptor retinoid binding protein gene expression
  JOURNAL   Mech. Dev. 82 (1-2), 165-169 (1999)
   PUBMED   10354480
REFERENCE   7  (bases 1 to 3011)
  AUTHORS   Nagao T, Leuzinger S, Acampora D, Simeone A, Finkelstein R,
            Reichert H and Furukubo-Tokunaga K.
  TITLE     Developmental rescue of Drosophila cephalic defects by the human
            Otx genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 95 (7), 3737-3742 (1998)
   PUBMED   9520436
REFERENCE   8  (bases 1 to 3011)
  AUTHORS   Kastury K, Druck T, Huebner K, Barletta C, Acampora D, Simeone A,
            Faiella A and Boncinelli E.
  TITLE     Chromosome locations of human EMX and OTX genes
  JOURNAL   Genomics 22 (1), 41-45 (1994)
   PUBMED   7959790
REFERENCE   9  (bases 1 to 3011)
  AUTHORS   Kumaran,N., Pennesi,M.E., Yang,P., Trzupek,K.M., Schlechter,C.,
            Moore,A.T., Weleber,R.G. and Michaelides,M.
  TITLE     Leber Congenital Amaurosis / Early-Onset Severe Retinal Dystrophy
            Overview
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   30285347
REFERENCE   10 (bases 1 to 3011)
  AUTHORS   Bardakjian,T., Weiss,A. and Schneider,A.
  TITLE     Microphthalmia/Anophthalmia/Coloboma Spectrum
  JOURNAL   (in) Adam MP, Ardinger HH, Pagon RA, Wallace SE, Bean LJH, Stephens
            K and Amemiya A (Eds.);
            GENEREVIEWS((R));
            (1993)
   PUBMED   20301552
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL161757.4, AB593058.1 and
            BC032579.1.
            This sequence is a reference standard in the RefSeqGene project.
            On Jun 2, 2019 this sequence version replaced NM_021728.3.
            
            Summary: This gene encodes a member of the bicoid subfamily of
            homeodomain-containing transcription factors. The encoded protein
            acts as a transcription factor and plays a role in brain,
            craniofacial, and sensory organ development. The encoded protein
            also influences the proliferation and differentiation of
            dopaminergic neuronal progenitor cells during mitosis. Mutations in
            this gene cause syndromic microphthalmia 5 (MCOPS5) and combined
            pituitary hormone deficiency 6 (CPHD6). This gene is also suspected
            of having an oncogenic role in medulloblastoma. Alternative
            splicing results in multiple transcript variants encoding distinct
            isoforms. Pseudogenes of this gene are known to exist on
            chromosomes two and nine. [provided by RefSeq, Jul 2012].
            
            Transcript Variant: This variant (1) encodes the longer isoform
            (a). Variants 1 and 5 encode the same protein (isoform a).
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AB593058.1, SRR1660803.40199.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03465402, SAMN03465404
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on manual assertion, conservation,
                                      longest protein
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-3                 AL161757.4         55098-55100
            4-2207              AB593058.1         1-2204
            2208-2209           BC032579.1         2206-2207
            2210-3011           AL161757.4         64871-65672
FEATURES             Location/Qualifiers
     source          1..3011
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q22.3"
     gene            1..3011
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="orthodenticle homeobox 2"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
     exon            1..104
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       9
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1319288955"
     variation       16
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:922277261"
     variation       20
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1566628232"
     variation       22
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1039808944"
     variation       23
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:890444049"
     variation       23
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1386451269"
     variation       25
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:563987229"
     variation       26
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746287642"
     variation       31
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1050487280"
     variation       37
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:942960328"
     variation       40
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1225959412"
     variation       53
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281912525"
     variation       63
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323335951"
     variation       70
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209714103"
     variation       71
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1286733573"
     variation       72
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:932028137"
     variation       83
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:535146235"
     variation       84
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:566447220"
     variation       90
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:978863581"
     variation       91
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200705423"
     variation       95
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773133418"
     variation       96
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:913295719"
     variation       99
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:941214420"
     variation       100
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138281551"
     variation       101
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185374570"
     exon            105..168
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       105
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1307295522"
     variation       114
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150887670"
     variation       138
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1181907559"
     variation       150
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384758161"
     variation       161
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:780689107"
     misc_feature    165..167
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="upstream in-frame stop codon"
     exon            169..384
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       187
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:867047559"
     variation       191
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1463179835"
     variation       192
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1267978893"
     variation       196
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:566671671"
     variation       206
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:540831263"
     variation       222
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196562062"
     variation       223
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1056716757"
     variation       224
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1015703211"
     variation       229
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1473067950"
     variation       230
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161674671"
     variation       237
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:546858272"
     variation       238
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747816534"
     variation       241
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776104541"
     variation       242
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200002729"
     variation       243
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326480147"
     variation       244
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373972732"
     variation       245
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:564618315"
     variation       246..250
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccc"
                     /replace="ccccc"
                     /db_xref="dbSNP:1566625502"
     variation       246
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1312165040"
     variation       247
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779606022"
     variation       250
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758339288"
     variation       251
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1173169407"
     variation       253
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:905188703"
     variation       255
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:546311189"
     variation       259
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370535121"
     variation       261
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757069643"
     variation       267
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754146678"
     variation       268
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1209340201"
     variation       270
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1486905888"
     variation       271
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764157150"
     variation       278
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1230570861"
     variation       279
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756345000"
     variation       280
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1349359874"
     variation       281
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752785578"
     variation       282
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1051054473"
     CDS             288..1181
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="isoform a is encoded by transcript variant 1;
                     homeobox protein OTX2; orthodenticle homolog 2"
                     /codon_start=1
                     /product="homeobox protein OTX2 isoform a"
                     /protein_id="NP_068374.1"
                     /db_xref="CCDS:CCDS9728.1"
                     /db_xref="GeneID:5015"
                     /db_xref="HGNC:HGNC:8522"
                     /db_xref="MIM:600037"
                     /translation="
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL"
     misc_feature    order(426..440,444..446,495..497,513..515,552..554,
                     558..563,570..575,579..587,591..593)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(432..434,441..443,561..563,570..575,582..584)
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     misc_feature    435..593
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:333795"
     misc_feature    768..1013
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /note="Otx1 transcription factor; Region: TF_Otx;
                     pfam03529"
                     /db_xref="CDD:308893"
     variation       289
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1350877109"
     variation       291
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767603643"
     variation       292
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1412709573"
     variation       296
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:575736431"
     variation       302
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752010967"
     variation       310
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1400172157"
     variation       311
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1382934738"
     variation       312
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766756721"
     variation       317
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997349229"
     variation       318
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763234678"
     variation       320
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1186172721"
     variation       325
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776356711"
     variation       326
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768254721"
     variation       329
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760374061"
     variation       332
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:946757953"
     variation       341
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1445883508"
     variation       344
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774907916"
     variation       345
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771687556"
     variation       348
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1207963480"
     variation       349
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745822138"
     variation       350
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:779418668"
     variation       351
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200680654"
     variation       353
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778956556"
     variation       356
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770855748"
     variation       363
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749151724"
     variation       365..368
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ccc"
                     /replace="cccc"
                     /db_xref="dbSNP:786205874"
     variation       366
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1259224286"
     variation       371
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1284677631"
     variation       372
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777618282"
     variation       376
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756331034"
     variation       382
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752941534"
     exon            385..560
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       386
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1248637885"
     variation       387
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371205339"
     variation       388
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1232831265"
     variation       393
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:761773984"
     variation       402
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751692939"
     variation       405
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780106127"
     variation       409
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1449513107"
     variation       412..417
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:758119168"
     variation       412
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:758946986"
     variation       413
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750923926"
     variation       414
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374042850"
     variation       417
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1440715201"
     variation       428
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566624596"
     variation       430
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1555350405"
     variation       437
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246931412"
     variation       442
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203506236"
     variation       443
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1435887362"
     variation       449
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757602259"
     variation       454
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1229104622"
     variation       455
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1354433789"
     variation       458
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1347231732"
     variation       460..486
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="tagatgtgctggaagcactgtttgcca"
                     /db_xref="dbSNP:886044145"
     variation       463
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:567955379"
     variation       474
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368759331"
     variation       478..480
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="tgt"
                     /db_xref="dbSNP:1555350397"
     variation       478
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1368488675"
     variation       479
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141664597"
     variation       490
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759256101"
     variation       491
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774043425"
     variation       494
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765964221"
     variation       498
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1064795810"
     variation       500
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762821214"
     variation       503
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:867835552"
     variation       505
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1374187856"
     variation       513
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:773157352"
     variation       522
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1434432414"
     variation       530..547
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ga"
                     /replace="gaaaatcaacttgcccga"
                     /db_xref="dbSNP:1566624472"
     variation       533
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1390373654"
     variation       545
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769477143"
     variation       546
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:786205224"
     variation       551
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376651816"
     variation       557
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:747916036"
     exon            561..3011
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /inference="alignment:Splign:2.1.0"
     variation       561
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397190102"
     variation       576
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:104894464"
     variation       577
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200990681"
     variation       581
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1566623392"
     variation       583
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350254"
     variation       592
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:990697953"
     variation       594..613
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="caacaacagca"
                     /replace="caacaacagcaacaacagca"
                     /db_xref="dbSNP:1432265442"
     variation       594
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78953717"
     variation       596
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749788509"
     variation       603
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:786205884"
     variation       614
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867373003"
     variation       615
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566623353"
     variation       617
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778304481"
     variation       623
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536495343"
     variation       628
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751258203"
     variation       637
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:779696471"
     variation       638
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757971368"
     variation       639
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750013761"
     variation       640
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1421844456"
     variation       644
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958176763"
     variation       649
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764625033"
     variation       653
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761862286"
     variation       658
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753729345"
     variation       659
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763911822"
     variation       660
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:760396081"
     variation       663
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:925178840"
     variation       664
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1267666192"
     variation       666
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775702810"
     variation       667
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199799627"
     variation       669
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867148217"
     variation       672
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1294096975"
     variation       673
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774537529"
     variation       675
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:748205899"
     variation       679
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:970116042"
     variation       683
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749843466"
     variation       688
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778357805"
     variation       693
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770291855"
     variation       698
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772021946"
     variation       699
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74658806"
     variation       700
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867304376"
     variation       705
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758106958"
     variation       708..713
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="cccccc"
                     /replace="ccccccc"
                     /db_xref="dbSNP:1555350223"
     variation       708
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376333965"
     variation       710
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372008404"
     variation       711
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753783256"
     variation       712
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199761861"
     variation       713..716
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ctct"
                     /replace="ctctct"
                     /db_xref="dbSNP:1566623121"
     variation       713
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:553884027"
     variation       724
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:786205879"
     variation       728
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1018175216"
     variation       730
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201721391"
     variation       731
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147896150"
     variation       733
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771047348"
     variation       734
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763064579"
     variation       738
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770486100"
     variation       739
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748631596"
     variation       740
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777104497"
     variation       742
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768857621"
     variation       743
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325619239"
     variation       745
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040844433"
     variation       746
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34537598"
     variation       751
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200171280"
     variation       753
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1306099663"
     variation       764
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:373798705"
     variation       769
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1345597863"
     variation       770
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538192166"
     variation       774..775
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gc"
                     /replace="gcgc"
                     /db_xref="dbSNP:786205873"
     variation       774
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173013598"
     variation       781
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:756087368"
     variation       791
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:752526255"
     variation       801
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370354056"
     variation       806
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868464317"
     variation       808
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1224751397"
     variation       812
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767374937"
     variation       821
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:886043793"
     variation       827
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368033398"
     variation       830
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184804231"
     variation       832
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566622915"
     variation       837
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751820068"
     variation       839
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:766762080"
     variation       840
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1209472542"
     variation       843
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1344213875"
     variation       848
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:104894465"
     variation       854
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1257366193"
     variation       861
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:773463323"
     variation       863
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1334931058"
     variation       865
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286159089"
     variation       867
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765382721"
     variation       868
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762435469"
     variation       871
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776964451"
     variation       873
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:397514463"
     variation       874
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142205965"
     variation       878
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747279627"
     variation       879
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1173365017"
     variation       884
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775913832"
     variation       888
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748910557"
     variation       889
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:755578825"
     variation       901
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473138354"
     variation       902
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1216205714"
     variation       903
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:907201088"
     variation       911
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196833377"
     variation       920
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1257411968"
     variation       928
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150982073"
     variation       930
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780929725"
     variation       933
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1470784217"
     variation       942
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:754929157"
     variation       943
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751376563"
     variation       945..946
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ct"
                     /replace="g"
                     /db_xref="dbSNP:1566622642"
     variation       948
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:548455339"
     variation       950
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142743327"
     variation       951
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374968145"
     variation       952
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1213822105"
     variation       954
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1419408753"
     variation       955
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:916022550"
     variation       957..960
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ggg"
                     /replace="gggg"
                     /db_xref="dbSNP:1566622571"
     variation       960
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750626422"
     variation       961
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:928898444"
     variation       964
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765441049"
     variation       966
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868121860"
     variation       967
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761733794"
     variation       969
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:529946021"
     variation       970..980
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcccatgggt"
                     /db_xref="dbSNP:745480462"
     variation       971
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1281107964"
     variation       978
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1209058851"
     variation       980
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764571884"
     variation       985
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370761964"
     variation       992
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775876318"
     variation       1000
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144449264"
     variation       1002
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772782540"
     variation       1007
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1330502209"
     variation       1011
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769304167"
     variation       1015
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1006268708"
     variation       1018
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747665958"
     variation       1021
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:868295626"
     variation       1026
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143131956"
     variation       1030
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199650198"
     variation       1031
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1026307269"
     variation       1035
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:768514532"
     variation       1036
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746941491"
     variation       1037
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1292858286"
     variation       1040
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210252921"
     variation       1041
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1555350163"
     variation       1044
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139800030"
     variation       1045
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758228717"
     variation       1051
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781096873"
     variation       1052
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:977939396"
     variation       1053
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1358330775"
     variation       1055
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1284735568"
     variation       1056
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:993488539"
     variation       1057
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363170287"
     variation       1066..1071
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caacca"
                     /db_xref="dbSNP:1555350156"
     variation       1066
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322804815"
     variation       1069
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750679604"
     variation       1070
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1364445625"
     variation       1074
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:867979918"
     variation       1079
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290281755"
     variation       1084
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:779220317"
     variation       1094
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1321908772"
     variation       1111
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1407465215"
     variation       1113
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1164601677"
     variation       1118
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78559885"
     variation       1127
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201396096"
     variation       1131
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:764205900"
     variation       1132
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:964796364"
     variation       1134
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1566622143"
     variation       1149
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1017328977"
     variation       1153
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761138937"
     variation       1159
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753156713"
     variation       1160
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759833842"
     variation       1168
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774680300"
     variation       1172
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1219049095"
     variation       1183
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370275924"
     variation       1186
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776053080"
     variation       1187
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204435968"
     variation       1191
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:171978"
     variation       1192
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340168757"
     variation       1198..1202
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tttt"
                     /replace="ttttt"
                     /replace="tttttt"
                     /db_xref="dbSNP:1197615289"
     variation       1200
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1299838408"
     variation       1201
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192883185"
     variation       1203
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:889592710"
     variation       1206
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229234977"
     variation       1207
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:780072062"
     variation       1208
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1273316573"
     variation       1209
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1457686689"
     variation       1211
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772006682"
     variation       1215
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182392988"
     variation       1221
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1245381513"
     variation       1222
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3742576"
     variation       1223
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:866064360"
     variation       1224
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:558072316"
     variation       1225..1227
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gg"
                     /replace="ggg"
                     /db_xref="dbSNP:1566622028"
     variation       1225
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1485650070"
     variation       1227
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757464106"
     variation       1232
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1428446118"
     variation       1237
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:993744729"
     variation       1239
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:907483952"
     variation       1256
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1329597774"
     variation       1260..1263
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1398080713"
     variation       1269
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1463821799"
     variation       1270
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1465056084"
     variation       1283
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1337262345"
     variation       1292
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1399289149"
     variation       1302
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:575988911"
     variation       1305
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:555242082"
     variation       1306
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561466216"
     variation       1307
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750146313"
     variation       1313
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1190100508"
     variation       1316
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1229755388"
     variation       1321
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:894481205"
     variation       1327
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543291377"
     variation       1328
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1478094910"
     variation       1333
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482490326"
     variation       1334
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:928301679"
     variation       1337
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:981657803"
     variation       1339
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1255131942"
     variation       1341
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75947588"
     variation       1344
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764880954"
     variation       1346
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1195329294"
     variation       1354
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1420874693"
     variation       1356
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1477169612"
     variation       1359
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:916081360"
     variation       1360
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1360812788"
     variation       1378
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464414724"
     variation       1384
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:985397680"
     variation       1388
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:952150059"
     variation       1400
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050559"
     variation       1404
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1402106303"
     variation       1408
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1026840321"
     variation       1409
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903692952"
     variation       1411
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1224139958"
     variation       1429
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1042235855"
     variation       1432
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:945281239"
     variation       1435
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:923213099"
     variation       1437..1444
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caaaagca"
                     /db_xref="dbSNP:976420913"
     variation       1442
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:553969803"
     variation       1443
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972142607"
     variation       1449
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:943019365"
     variation       1454
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:538805998"
     variation       1455
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1487017770"
     variation       1458
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1218381719"
     variation       1462
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1260532137"
     variation       1471
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1487705519"
     variation       1473
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1199472030"
     variation       1489
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1427268662"
     variation       1497
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142727455"
     variation       1502
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1219845536"
     variation       1518
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984556416"
     variation       1519
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951811707"
     variation       1520
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556614831"
     variation       1521
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:3215889"
     variation       1522
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:869122184"
     variation       1522
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1555350067"
     variation       1523
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889740596"
     variation       1526
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:537889967"
     variation       1531
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1281712076"
     variation       1534
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1028147110"
     variation       1537
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295354677"
     variation       1540
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:567634820"
     variation       1547
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219167817"
     variation       1552
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1331775492"
     variation       1558
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:971574768"
     variation       1564
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1024531987"
     variation       1568
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:372333803"
     variation       1569
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1013593016"
     variation       1578
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1011851024"
     variation       1585
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621702"
     variation       1589
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1357328033"
     variation       1595
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175318513"
     variation       1598
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1164324256"
     variation       1603
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1566621689"
     variation       1605
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778705827"
     variation       1607
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414498885"
     variation       1608
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761387465"
     variation       1615
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1052830345"
     variation       1617
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190556214"
     variation       1633
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:894436849"
     variation       1641
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1033466446"
     variation       1643
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1251091564"
     variation       1644
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:934406906"
     variation       1652
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621652"
     variation       1661
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1441364759"
     variation       1671..1676
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgattg"
                     /db_xref="dbSNP:149455658"
     variation       1672
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369779296"
     variation       1681
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1438677729"
     variation       1684
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:903304073"
     variation       1690
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754230866"
     variation       1702
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1042182924"
     variation       1707
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1045463851"
     variation       1712
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1435793143"
     variation       1718
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868860898"
     variation       1724
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:948990605"
     variation       1725
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:945186505"
     variation       1727
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379724611"
     variation       1737
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:916180198"
     variation       1741..1746
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ca"
                     /replace="caatca"
                     /db_xref="dbSNP:1179283220"
     variation       1746..1747
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1482497443"
     variation       1747..1754
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gtgtgt"
                     /replace="gtgtgtgt"
                     /db_xref="dbSNP:886050558"
     variation       1747
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:901684336"
     variation       1754
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228539728"
     variation       1759
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291528909"
     variation       1762
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1319424226"
     variation       1763
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1237362268"
     variation       1766
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1251855513"
     variation       1776
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764392879"
     variation       1786..1789
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1176602266"
     variation       1796
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211453769"
     variation       1798
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1040254525"
     variation       1804..1807
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="tg"
                     /replace="tgtg"
                     /db_xref="dbSNP:1486654604"
     variation       1804
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:984960530"
     variation       1810
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1283965626"
     variation       1811
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1411874833"
     variation       1814
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536571793"
     variation       1819
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1239590153"
     variation       1824
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:930784453"
     variation       1828
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:886050557"
     variation       1829
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:886050556"
     variation       1830
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:972087134"
     variation       1831
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:966101197"
     variation       1834..1835
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1331182993"
     variation       1835
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:984894491"
     variation       1848
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:184421963"
     variation       1857
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1376736111"
     variation       1858
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56245644"
     variation       1861
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1376475442"
     variation       1862
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1227306464"
     variation       1871
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:986127085"
     variation       1872
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1566621429"
     variation       1873..1884
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="ttataa"
                     /replace="ttataattataa"
                     /db_xref="dbSNP:971821568"
     variation       1875
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1319311232"
     variation       1878
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1196710335"
     variation       1879
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:58246365"
     variation       1880
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1257294974"
     variation       1887
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1448679301"
     variation       1895
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1211938034"
     variation       1903
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192422162"
     variation       1910
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472585406"
     variation       1923
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1028682339"
     variation       1945
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:775857186"
     variation       1947
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1295783908"
     variation       1948
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1024896852"
     variation       1959
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:957402368"
     variation       1960
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:138197536"
     variation       1962
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:998603699"
     variation       1969
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332601359"
     variation       1983
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:906986413"
     variation       1985
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045412281"
     variation       1993
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1013022875"
     variation       2001..2004
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="aaaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:1298354320"
     variation       2003
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187055500"
     variation       2009
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772253161"
     variation       2011
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1341863555"
     variation       2014
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216233957"
     variation       2024
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1422373370"
     variation       2039
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:549838567"
     variation       2079
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1345627274"
     variation       2091
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220796650"
     variation       2100
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74517617"
     variation       2101
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80140046"
     variation       2102
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78935901"
     variation       2103
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:759551235"
     variation       2104..2108
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="gt"
                     /replace="gtcgt"
                     /db_xref="dbSNP:1000175646"
     variation       2104
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1441567214"
     variation       2106
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781146554"
     variation       2107
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1036526594"
     variation       2114
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:886050555"
     variation       2115
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1192998502"
     variation       2121
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1430693238"
     variation       2139
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767628237"
     variation       2144
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1215947126"
     variation       2145
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:944782027"
     variation       2146
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1488676963"
     variation       2147
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:57390094"
     variation       2148
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:967368837"
     variation       2152..2153
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1298489300"
     variation       2153
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:912005555"
     variation       2188
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:986130839"
     variation       2189
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184224534"
     variation       2197
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1228720148"
     variation       2207
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1020294698"
     variation       2209
                     /gene="OTX2"
                     /gene_synonym="CPHD6; MCOPS5"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:998230048"
ORIGIN      
agcaaatctccctgagagcgggaccggcctcagctccaacacagcctccactgtgattaaaaataaaaattgctagagcagccctcactcgccacatctactttgatagctggctatttggaatttaaaggatatttgactttttctaacctcccatgaggctgtaagttccactgctccaaacccacccaccaaggactctgaacctgtccaccccgggcgcatcaagatcttccagctgggtacccccgatttgggccgactttgcacctccaaacaaccttagcatgatgtcttatcttaagcaaccgccttacgcagtcaatgggctgagtctgaccacttcgggtatggacttgctgcacccctccgtgggctacccggggccctgggcttcttgtcccgcagccaccccccggaaacagcgccgggagaggacgacgttcactcgggcgcagctagatgtgctggaagcactgtttgccaagacccggtacccagacatcttcatgcgagaggaggtggcactgaaaatcaacttgcccgagtcgagggtgcaggtatggtttaagaatcgaagagctaagtgccgccaacaacagcaacaacagcagaatggaggtcaaaacaaagtgagacctgccaaaaagaagacatctccagctcgggaagtgagttcagagagtggaacaagtggccaattcactcccccctctagcacctcagtcccgaccattgccagcagcagtgctcctgtgtctatctggagcccagcttccatctccccactgtcagatcccttgtccacctcctcttcctgcatgcagaggtcctatcccatgacctatactcaggcttcaggttatagtcaaggatatgctggctcaacttcctactttgggggcatggactgtggatcatatttgacccctatgcatcaccagcttcccggaccaggggccacactcagtcccatgggtaccaatgcagtcaccagccatctcaatcagtccccagcttctctttccacccagggatatggagcttcaagcttgggttttaactcaaccactgattgcttggattataaggaccaaactgcctcctggaagcttaacttcaatgctgactgcttggattataaagatcagacatcctcgtggaaattccaggttttgtgaagacctgtagaacctctttttgtgggtgatttttaaatatactgggctggacattccagttttagccaggcattggttaaaagagttagatgggatgatgctcagactcatctgatcaaagttccgagaggcatagaaggaaaaacgaagggccttagaggggcctacaaaccagcaacatgaaatggacaaaccaatctgcttaagatcctgtcatagttttagatcattggttatcctgatttgcaaagtgatcaaaagcattctagccatgtgcaaccaaacaccaccaaaaataaaatcaaacaaaactaagttgtgaaggaagggagggaaggtcatagccttcttaagcagaggtgttccattgttttagccaatccttggttgaatcttaggaatgaacagtgtctcaagctcattcacgtttcatgaccaactggtagttggcactgaaaaaacttttcagggctgtgtgaattgtgtgactgattgtcctagatgcactactttatttaaaaaataatgttcataaggagtcaatatgtagtttaagagacaatcagtgtgtgtcttataaatggtacatctgtggtttttaatctgtgctagacttcaaaactgtgatctcctgttattgtatgcaaccttgaactccacctctgcaggggttcttctgtgattaaataggttataattataagcaaaattcagagcaactgagtactgatctaaaaagattacctttggctggaggtgagctgcactgaaactttacgacaaaatgtctctggacaaagagagtcagagaagagaagcaaaaggacactaattcatctgtaatttactgttggtaagcctagcagtaaagagacattggtcaattgctctgaccctgatgaattattaaactgagatcattgtcgtttatgcttgcagatgttaaatggaaaagttatatatgcataaaccttttcttcctggatttggcagatatgtataattatattaaaatggttctagcacaacattgggtccagtttaattttacaccgctatttatgaataagaagcctacattcagcctttcctccccaaaacacgtttttcttaggacagagagtaaattagcaaacttatttttactttttttttttgctaatctatgcataaaatagatatgaatgacagtggtaggtagactttttgtgactttcatcaggattgctctgaaattgagtttggagagcctaacaacaagatcttgttttccttgcttttccctccctacttcaaacctgaacgatttcttaggcactttattagaatgttttaaaatatatcaagtttttaagagggaggaggagaattggagtatctctgaaaacatgagaatgacaagaatttcttgttactattctcttatttgattaaggggattttttttttttaacttccaaaaactgaggtaaacatgagagggagtgtaatcagaatctgaaagtaattcaggcagaaatgattcctgaacaaaagagtttcagaaaagttttaaaacctataatttcagtagttgaacataaggcaccctggtcagtttgtgtgtatgtgtttaagaaagtgccgagggggaaaaaatgggtcccttttcagttgtacctgcattttgtaaaccagtcaccagaaaagacaaatgggccaatgatcatggtgctcctcaggtaaaagcaatatttaatttcattttaagctgcttaagctcttacagctgaccaaaattaagtgactcttgattgtaacgttttaaatgaaggttagcagttgcaacca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]