LOCUS       NM_019381                898 bp    mRNA    linear   ROD 07-FEB-2025
DEFINITION  Rattus norvegicus transmembrane BAX inhibitor motif containing 6
            (Tmbim6), mRNA.
ACCESSION   NM_019381 XM_001063712 XM_576343
VERSION     NM_019381.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 898)
  AUTHORS   Chen,W., DU,H., Sha,Y., Zhou,Y., Liang,J., Chen,Y., Ma,Q., Wu,X.
            and Qian,G.
  TITLE     [Long noncoding RNA H19 promotes vascular calcification by
            repressing the Bax inhibitor 1/optic atrophy 1 pathway]
  JOURNAL   Nan Fang Yi Ke Da Xue Xue Bao 43 (9), 1469-1475 (2023)
   PUBMED   37814860
  REMARK    GeneRIF: [Long noncoding RNA H19 promotes vascular calcification by
            repressing the Bax inhibitor 1/optic atrophy 1 pathway].
REFERENCE   2  (bases 1 to 898)
  AUTHORS   Chen,Y., Liu,X., Li,L., He,X., Zheng,F., Zhang,Y., Gao,H., Jin,Z.,
            Wu,D., Wang,Q., Tao,H., Zhao,Y., Liu,W. and Zou,L.
  TITLE     Methyltransferase-like 3 aggravates endoplasmic reticulum stress in
            preeclampsia by targeting TMBIM6 in YTHDF2-dependent manner
  JOURNAL   Mol Med 29 (1), 19 (2023)
   PUBMED   36747144
  REMARK    GeneRIF: Methyltransferase-like 3 aggravates endoplasmic reticulum
            stress in preeclampsia by targeting TMBIM6 in YTHDF2-dependent
            manner.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 898)
  AUTHORS   Liu,J., Zhou,S., Zhang,Y., Li,X., Qian,X., Tao,W., Jin,L. and
            Zhao,J.
  TITLE     Bax inhibitor-1 suppresses early brain injury following
            experimental subarachnoid hemorrhage in rats
  JOURNAL   Int J Mol Med 42 (5), 2891-2902 (2018)
   PUBMED   30226536
  REMARK    GeneRIF: The present study suggested that Bax inhibitor-1 serves a
            neuroprotective role in Early brain injury following subarachnoid
            hemorrhage by attenuating bloodbrain barrier disruption, brain
            edema and apoptosis mediated by endoplasmic reticulum stress.
            Erratum:[Int J Mol Med. 2024 Apr;53(4):38. doi:
            10.3892/ijmm.2024.5362.. PMID: 38426556]
REFERENCE   4  (bases 1 to 898)
  AUTHORS   Liu,J., Zhou,S., Qian,X., Zhang,Y. and Zhao,J.
  TITLE     [Over-expressed Bax inhibitor 1 (BI-1) inhibits apoptosis of
            hippocampal neurons via endoplasmic reticulum IRE1-JNK pathway in
            rats with subarachnoid hemorrhage]
  JOURNAL   Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi 33 (10), 1316-1322 (2017)
   PUBMED   29169414
  REMARK    GeneRIF: Bax inhibitor-1 (BI-1) over-expression improved
            neurobehavioral score, decreased hippocampal neuron apoptosis rate,
            and also down-regulated IRE1 protein levels in the rats with
            subarachnoid hemorrhage (SAH).
REFERENCE   5  (bases 1 to 898)
  AUTHORS   Urresti,J., Ruiz-Meana,M., Coccia,E., Arevalo,J.C., Castellano,J.,
            Fernandez-Sanz,C., Galenkamp,K.M., Planells-Ferrer,L.,
            Moubarak,R.S., Llecha-Cano,N., Reix,S., Garcia-Dorado,D.,
            Barneda-Zahonero,B. and Comella,J.X.
  TITLE     Lifeguard Inhibits Fas Ligand-mediated Endoplasmic
            Reticulum-Calcium Release Mandatory for Apoptosis in Type II
            Apoptotic Cells
  JOURNAL   J Biol Chem 291 (3), 1221-1234 (2016)
   PUBMED   26582200
REFERENCE   6  (bases 1 to 898)
  AUTHORS   Chae,H.J., Kim,H.R., Xu,C., Bailly-Maitre,B., Krajewska,M.,
            Krajewski,S., Banares,S., Cui,J., Digicaylioglu,M., Ke,N.,
            Kitada,S., Monosov,E., Thomas,M., Kress,C.L., Babendure,J.R.,
            Tsien,R.Y., Lipton,S.A. and Reed,J.C.
  TITLE     BI-1 regulates an apoptosis pathway linked to endoplasmic reticulum
            stress
  JOURNAL   Mol Cell 15 (3), 355-366 (2004)
   PUBMED   15304216
REFERENCE   7  (bases 1 to 898)
  AUTHORS   Grzmil,M., Thelen,P., Hemmerlein,B., Schweyer,S., Voigt,S., Mury,D.
            and Burfeind,P.
  TITLE     Bax inhibitor-1 is overexpressed in prostate cancer and its
            specific down-regulation by RNA interference leads to cell death in
            human prostate carcinoma cells
  JOURNAL   Am J Pathol 163 (2), 543-552 (2003)
   PUBMED   12875974
REFERENCE   8  (bases 1 to 898)
  AUTHORS   Jean,J.C., Oakes,S.M. and Joyce-Brady,M.
  TITLE     The Bax inhibitor-1 gene is differentially regulated in adult
            testis and developing lung by two alternative TATA-less promoters
  JOURNAL   Genomics 57 (2), 201-208 (1999)
   PUBMED   10198159
REFERENCE   9  (bases 1 to 898)
  AUTHORS   Xu,Q. and Reed,J.C.
  TITLE     Bax inhibitor-1, a mammalian apoptosis suppressor identified by
            functional screening in yeast
  JOURNAL   Mol Cell 1 (3), 337-346 (1998)
   PUBMED   9660918
REFERENCE   10 (bases 1 to 898)
  AUTHORS   Walter,L., Dirks,B., Rothermel,E., Heyens,M., Szpirer,C., Levan,G.
            and Gunther,E.
  TITLE     A novel, conserved gene of the rat that is developmentally
            regulated in the testis
  JOURNAL   Mamm Genome 5 (4), 216-221 (1994)
   PUBMED   8012111
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC058478.1.
            
            On or before Jan 28, 2007 this sequence version replaced
            XM_576343.2, XM_001063712.1, NM_019381.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC058478.1, FQ218441.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMD00132261, SAMD00132262
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-898               BC058478.1         7-904
FEATURES             Location/Qualifiers
     source          1..898
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10116"
                     /chromosome="7"
                     /map="7q36"
     gene            1..898
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="transmembrane BAX inhibitor motif containing 6"
                     /db_xref="GeneID:24822"
                     /db_xref="RGD:3842"
     exon            1..53
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    47..49
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="upstream in-frame stop codon"
     exon            54..138
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     CDS             83..796
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="testis enhanced gene transcript; Bax inhibitor-1;
                     BI-1; testis-enhanced gene transcript protein;
                     transmembrane BAX inhibitor motif-containing protein 6"
                     /codon_start=1
                     /product="bax inhibitor 1"
                     /protein_id="NP_062254.2"
                     /db_xref="GeneID:24822"
                     /db_xref="RGD:3842"
                     /translation="

MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHVVTRFIQAGLLSALGALALMICLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALELCIAINPSILPTAFMGTAMIFTCFSLSALYARRRSYLFLGGILMSAMSLMFVSSLGNLFFGSIWLFQANLYMGLLVMCGFVLFDTQLIIEKAEHGDKDYIWHCIDLFLDFVTLFRKLMLILAFNEKDKKKEKK"

     misc_feature    128..766
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="BAX inhibitor (BI)-1; Region: BI-1; cd10430"
                     /db_xref="CDD:198412"
     misc_feature    170..232
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    239..301
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    341..403
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    419..481
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    500..562
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     misc_feature    581..643
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /note="propagated from UniProtKB/Swiss-Prot (P55062.2);
                     transmembrane region"
     exon            139..247
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            248..368
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            369..417
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            418..515
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            516..595
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            596..696
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            697..772
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
     exon            773..898
                     /gene="Tmbim6"
                     /gene_synonym="Ab1-011; Ac1-149; Cc1-27; Tegt"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

agcacatccggttttagccgagcggggaagctccgaagaggtgggctaagaagcggaggctgcgctgaacagacttggagccatgaatatatttgatcggaagatcaactttgatgccctcttaaaattttcccacataactccctccacacagcagcacctaaagaaggtctatgccagttttgcactgtgcatgtttgtggcagcagcaggggcctatgtccatgtggtcacacgtttcatccaggctggcctgctctctgccctgggcgccctggccttgatgatttgcctgatggccacacctcacagccatgagacggagcagaagaggctgggactgctcgctggcttcgccttccttacaggagttggcctgggacctgccctggagctgtgcattgccatcaaccccagcatcctccccacggccttcatgggcacggccatgatcttcacctgcttcagcctgagtgccctctacgccaggcgccggagttacctctttttgggaggtatcttgatgtcagccatgagcctcatgttcgtgtcctctctggggaaccttttctttggatccatttggctgttccaggcaaacctgtacatggggctgctggtcatgtgcggctttgtcctcttcgacactcagctcattattgaaaaggctgaacacggagacaaggattacatctggcactgcattgacctcttcttggacttcgttacactcttcaggaagctcatgctgatcttggccttcaatgagaaggacaaaaagaaagagaagaagtgacgtggtgatcgatcggcctctcccagctcgccttctctccctcagccccgtttctttgcacacatcacaggtgtcgtgtcccatgacaatgaaaagcatcag

//