2025-07-09 14:59:56, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_012982 1976 bp mRNA linear ROD 31-MAR-2024 DEFINITION Rattus norvegicus msh homeobox 2 (Msx2), mRNA. ACCESSION NM_012982 VERSION NM_012982.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1976) AUTHORS Liu,F., Liang,Y. and Lin,X. TITLE MiR-151b inhibits osteoblast differentiation via downregulating Msx2 JOURNAL Connect Tissue Res 63 (2), 112-123 (2022) PUBMED 33691558 REMARK GeneRIF: MiR-151b inhibits osteoblast differentiation via downregulating Msx2. REFERENCE 2 (bases 1 to 1976) AUTHORS Singh,M., Del Carpio-Cano,F.E., Monroy,M.A., Popoff,S.N. and Safadi,F.F. TITLE Homeodomain transcription factors regulate BMP-2-induced osteoactivin transcription in osteoblasts JOURNAL J Cell Physiol 227 (1), 390-399 (2012) PUBMED 21503878 REMARK GeneRIF: OA transcription is differentially regulated by Dlx3, Dlx5, and Msx2 during osteoblast differentiation. REFERENCE 3 (bases 1 to 1976) AUTHORS Le Bouffant,R., Souquet,B., Duval,N., Duquenne,C., Herve,R., Frydman,N., Robert,B., Habert,R. and Livera,G. TITLE Msx1 and Msx2 promote meiosis initiation JOURNAL Development 138 (24), 5393-5402 (2011) PUBMED 22071108 REFERENCE 4 (bases 1 to 1976) AUTHORS Bensoussan-Trigano,V., Lallemand,Y., Saint Cloment,C. and Robert,B. TITLE Msx1 and Msx2 in limb mesenchyme modulate digit number and identity JOURNAL Dev Dyn 240 (5), 1190-1202 (2011) PUBMED 21465616 REFERENCE 5 (bases 1 to 1976) AUTHORS Suga,T., Iso,T., Shimizu,T., Tanaka,T., Yamagishi,S., Takeuchi,M., Imaizumi,T. and Kurabayashi,M. TITLE Activation of receptor for advanced glycation end products induces osteogenic differentiation of vascular smooth muscle cells JOURNAL J Atheroscler Thromb 18 (8), 670-683 (2011) PUBMED 21512281 REMARK GeneRIF: activation of RAGE not only inhibits myocardin-dependent SMC gene expression, but also induces osteogenic differentiation of vascular SMC through Notch/Msx2 induction REFERENCE 6 (bases 1 to 1976) AUTHORS Ma,L., Golden,S., Wu,L. and Maxson,R. TITLE The molecular basis of Boston-type craniosynostosis: the Pro148-->His mutation in the N-terminal arm of the MSX2 homeodomain stabilizes DNA binding without altering nucleotide sequence preferences JOURNAL Hum Mol Genet 5 (12), 1915-1920 (1996) PUBMED 8968743 REFERENCE 7 (bases 1 to 1976) AUTHORS Phippard,D.J., Weber-Hall,S.J., Sharpe,P.T., Naylor,M.S., Jayatalake,H., Maas,R., Woo,I., Roberts-Clark,D., Francis-West,P.H., Liu,Y.H., Maxson,R., Hill,R.E. and Dale,T.C. TITLE Regulation of Msx-1, Msx-2, Bmp-2 and Bmp-4 during foetal and postnatal mammary gland development JOURNAL Development 122 (9), 2729-2737 (1996) PUBMED 8787747 REFERENCE 8 (bases 1 to 1976) AUTHORS Catron,K.M., Wang,H., Hu,G., Shen,M.M. and Abate-Shen,C. TITLE Comparison of MSX-1 and MSX-2 suggests a molecular basis for functional redundancy JOURNAL Mech Dev 55 (2), 185-199 (1996) PUBMED 8861098 REMARK Erratum:[Mech Dev 1996 May;56(1-2):223] REFERENCE 9 (bases 1 to 1976) AUTHORS Towler,D.A., Rutledge,S.J. and Rodan,G.A. TITLE Msx-2/Hox 8.1: a transcriptional regulator of the rat osteocalcin promoter JOURNAL Mol Endocrinol 8 (11), 1484-1493 (1994) PUBMED 7877617 REFERENCE 10 (bases 1 to 1976) AUTHORS Begue-Kirn,C., Smith,A.J., Loriot,M., Kupferle,C., Ruch,J.V. and Lesot,H. TITLE Comparative analysis of TGF beta s, BMPs, IGF1, msxs, fibronectin, osteonectin and bone sialoprotein gene expression during normal and in vitro-induced odontoblast differentiation JOURNAL Int J Dev Biol 38 (3), 405-420 (1994) PUBMED 7848824 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from JAXUCZ010000017.1. On Dec 8, 2006 this sequence version replaced NM_012982.2. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR26360194.429127.1, SRR26643295.53820.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760386, SAMEA5760393 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-379 JAXUCZ010000017.1 11102284-11102662 380-1976 JAXUCZ010000017.1 11106353-11107949 FEATURES Location/Qualifiers source 1..1976 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="17" /map="17p14" gene 1..1976 /gene="Msx2" /note="msh homeobox 2" /db_xref="GeneID:25483" /db_xref="RGD:3116" CDS 1..804 /gene="Msx2" /note="hox-8.1; homeobox protein Hox-8-1; msh homeo box homolog 2" /codon_start=1 /product="homeobox protein MSX-2" /protein_id="NP_037114.2" /db_xref="GeneID:25483" /db_xref="RGD:3116" /translation="
MASPSKGGDLFSSDEEGPAVLAGPGPGPGGAEGGAEERRVKVSSLPFSVEALMSDKKPPKESPAVPPDCASAGAVLRPLLLPGHGVRDAHSPGPLVKPFETASVKSENSEDGAPWIQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYSASYPFHRPVLPIPPVGLYATPVGYGMYHLS"
misc_feature 427..597 /gene="Msx2" /note="Region: Homeodomain; pfam00046" /db_xref="CDD:459649" exon 1..379 /gene="Msx2" /inference="alignment:Splign:2.1.0" exon 380..1976 /gene="Msx2" /inference="alignment:Splign:2.1.0" ORIGIN
atggcttctccgtccaaaggcggtgacttgttttcgtctgatgaggagggccccgcggtgctggccggcccgggccccgggcctggaggagccgagggcggcgcggaggagcgcagggtcaaggtctccagcctgcccttcagcgtggaggcgctcatgtccgacaagaagccgcccaaggaatcgcccgcggtgccacccgactgcgcctcggctggcgctgtcctgcggccgctgttgctgccgggacacggcgtccgggacgctcacagtcccgggcctctcgtcaagcccttcgagaccgcctcggtcaagtcggaaaattccgaagacggagcgccgtggatacaggagcccggcagatactccccgccgcccagacacatgagccccaccacctgcaccctgaggaaacacaagaccaaccggaagccacgcacaccgttcaccacgtcccagcttctagccttggagcgcaagttccgccagaaacagtacctctccatcgcagagcgggccgagttctccagctctctgaaccttacagaaacccaggtcaaaatctggttccagaaccgaagggctaaggcaaaaagactgcaggaggcggaactggaaaagctgaaaatggctgccaaacctatgctgccctcgggcttcagtctgcccttccctatcaactcccccttgcaagcggcatccatatacagcgcctcctaccccttccatagacctgtgcttcccatcccgcctgtgggactctatgccacgccggtgggatatggcatgtaccatctatcctaaagaagaccagatggacacactctaggatggatgtttgtggaaagcattcccctccctctccaggaaggcggtgccaattttgctcctgaacgcaaaccctgcgttgtcgccctaagcaacaggcctgtgggggggccacttgatacagagtgaatttgttatttacgtgagaggcactaagaccgattttgttttcataatttcccaaatgtccccttttcctctcacagttattggctctgctagtttttatgtataaatatataataaaatataagactttttatatgccagatgtaaaaattcaagttattttggaaggcaaaatttatatatacgcttatccatttttctagatagcattttcttaagatattgtgtttagtccatttgctaccttttcttaaagggaaagagatttgtttgcagaactttcaaggaggatggacttgcttatggaggacatgccaggagtagacatagtgcatacaagatacagtttcagatatattcttgcaagggaagggggatgtgtaacatgttcttatgcattttaggtgcgtaagaaacaaaacctcttgagatgcacatttgatcttatttttctctcttctccattccatgttgtcaaatctgaggataactctgagaattactcagggtaaaagtgggattccatttcagggccctggcgtgcgagggtttagaagataaaacttgtgtaggaattggtttctgtgaaatgctaactacatcagtcctcacagggcacagaggagattgcaagagggcgtagttaaatatctgcttagaaatgagtgtcttgtaactgttgcctatatttgaaagattcttcaacagtccatagaatcaggaaggggaaaaaatgctttctctctgtgtgtgtgtacttactgtatgtgctaaatgtattagggactcgaacgtgtttggggtagacaatgaagccatgtgttgggcttggtggaaacaaacggtgttgtcagacaacacagtcagctagccccttggtctttcacctgcctgtccacctcttcccaatatatttttatcccgttgaaagggtatcttgtataattttatatattttattgaagagttatttcttatctcatactctgaattaaattaaaatgttttattgcagtaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]