ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-19 02:12:08, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_012943 1390 bp mRNA linear ROD 22-JUN-2025 DEFINITION Rattus norvegicus distal-less homeobox 5 (Dlx5), mRNA. ACCESSION NM_012943 VERSION NM_012943.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. REFERENCE 1 (bases 1 to 1390) AUTHORS Li,X., Wu,Y., Xie,F., Zhang,F., Zhang,S., Zhou,J., Chen,D. and Liu,A. TITLE miR-339-5p negatively regulates loureirin A-induced hair follicle stem cell differentiation by targeting DLX5 JOURNAL Mol Med Rep 18 (2), 1279-1286 (2018) PUBMED 29901112 REMARK GeneRIF: these results suggest that miR3395p negatively regulated loureirin Ainduced HFSC differentiation by targeting DLX5, resulting in Wnt/betacatenin signaling pathway inhibition. REFERENCE 2 (bases 1 to 1390) AUTHORS Garaffo,G., Conte,D., Provero,P., Tomaiuolo,D., Luo,Z., Pinciroli,P., Peano,C., D'Atri,I., Gitton,Y., Etzion,T., Gothilf,Y., Gays,D., Santoro,M.M. and Merlo,G.R. TITLE The Dlx5 and Foxg1 transcription factors, linked via miRNA-9 and -200, are required for the development of the olfactory and GnRH system JOURNAL Mol Cell Neurosci 68, 103-119 (2015) PUBMED 25937343 REFERENCE 3 (bases 1 to 1390) AUTHORS Takai,H., Mezawa,M., Choe,J., Nakayama,Y. and Ogata,Y. TITLE Osteogenic transcription factors and proto-oncogene regulate bone sialoprotein gene transcription JOURNAL J Oral Sci 55 (3), 209-215 (2013) PUBMED 24042587 REMARK GeneRIF: results demonstrate that overexpression of Runx2, Dlx5 or c-Src stimulates BSP transcription, and suggest that Runx2, Dlx5 and c-Src might be crucial transcriptional regulators of mineralization and bone formation REFERENCE 4 (bases 1 to 1390) AUTHORS Singh,M., Del Carpio-Cano,F.E., Monroy,M.A., Popoff,S.N. and Safadi,F.F. TITLE Homeodomain transcription factors regulate BMP-2-induced osteoactivin transcription in osteoblasts JOURNAL J Cell Physiol 227 (1), 390-399 (2012) PUBMED 21503878 REMARK GeneRIF: OA transcription is differentially regulated by Dlx3, Dlx5, and Msx2 during osteoblast differentiation. REFERENCE 5 (bases 1 to 1390) AUTHORS Hie,M., Iitsuka,N., Otsuka,T., Nakanishi,A. and Tsukamoto,I. TITLE Zinc deficiency decreases osteoblasts and osteoclasts associated with the reduced expression of Runx2 and RANK JOURNAL Bone 49 (6), 1152-1159 (2011) PUBMED 21893222 REFERENCE 6 (bases 1 to 1390) AUTHORS Merlo,G.R., Paleari,L., Mantero,S., Genova,F., Beverdam,A., Palmisano,G.L., Barbieri,O. and Levi,G. TITLE Mouse model of split hand/foot malformation type I JOURNAL Genesis 33 (2), 97-101 (2002) PUBMED 12112878 REFERENCE 7 (bases 1 to 1390) AUTHORS Eisenstat,D.D., Liu,J.K., Mione,M., Zhong,W., Yu,G., Anderson,S.A., Ghattas,I., Puelles,L. and Rubenstein,J.L. TITLE DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal forebrain differentiation JOURNAL J Comp Neurol 414 (2), 217-237 (1999) PUBMED 10516593 REFERENCE 8 (bases 1 to 1390) AUTHORS Liu,J.K., Ghattas,I., Liu,S., Chen,S. and Rubenstein,J.L. TITLE Dlx genes encode DNA-binding proteins that are expressed in an overlapping and sequential pattern during basal ganglia differentiation JOURNAL Dev Dyn 210 (4), 498-512 (1997) PUBMED 9415433 REFERENCE 9 (bases 1 to 1390) AUTHORS Shirasawa,T., Sakamoto,K. and Tkahashi,H. TITLE Molecular cloning and evolutional analysis of a mammalian homologue of the Distal-less 3 (Dlx-3) homeobox gene JOURNAL FEBS Lett 351 (3), 380-384 (1994) PUBMED 7915995 REFERENCE 10 (bases 1 to 1390) AUTHORS Zhao,G.Q., Zhao,S., Zhou,X., Eberspaecher,H., Solursh,M. and de Crombrugghe,B. TITLE rDlx, a novel distal-less-like homeoprotein is expressed in developing cartilages and discrete neuronal tissues JOURNAL Dev Biol 164 (1), 37-51 (1994) PUBMED 7913069 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from L24443.1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: L24443.1, D31734.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA5760396 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on conservation, expression, longest protein ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1390 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="Sprague-Dawley" /db_xref="taxon:10116" /chromosome="4" /map="4q21" gene 1..1390 /gene="Dlx5" /gene_synonym="RDLX" /note="distal-less homeobox 5" /db_xref="GeneID:25431" /db_xref="RGD:2506" exon 1..533 /gene="Dlx5" /gene_synonym="RDLX" /inference="alignment:Splign:2.1.0" misc_feature 155..157 /gene="Dlx5" /gene_synonym="RDLX" /note="upstream in-frame stop codon" CDS 179..1048 /gene="Dlx5" /gene_synonym="RDLX" /note="DLX-3; homeobox protein DLX-3" /codon_start=1 /product="homeobox protein DLX-5" /protein_id="NP_037075.1" /db_xref="GeneID:25431" /db_xref="RGD:2506" /translation="
MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYRKALNPYQYQYHSVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPTTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY"
misc_feature 179..325
/gene="Dlx5"
/gene_synonym="RDLX"
/note="propagated from UniProtKB/Swiss-Prot (P50575.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 272..532
/gene="Dlx5"
/gene_synonym="RDLX"
/note="Homeobox protein distal-less-like N terminal;
Region: DLL_N; pfam12413"
/db_xref="CDD:463567"
misc_feature 278..280
/gene="Dlx5"
/gene_synonym="RDLX"
/note="Phosphoserine, by MAPK14, in vitro.
/evidence=ECO:0000250|UniProtKB:P70396; propagated from
UniProtKB/Swiss-Prot (P50575.1); phosphorylation site"
misc_feature 590..760
/gene="Dlx5"
/gene_synonym="RDLX"
/note="Region: Homeodomain; pfam00046"
/db_xref="CDD:459649"
misc_feature 770..937
/gene="Dlx5"
/gene_synonym="RDLX"
/note="propagated from UniProtKB/Swiss-Prot (P50575.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 827..829
/gene="Dlx5"
/gene_synonym="RDLX"
/note="Phosphoserine, by MAPK14, in vitro.
/evidence=ECO:0000250|UniProtKB:P70396; propagated from
UniProtKB/Swiss-Prot (P50575.1); phosphorylation site"
misc_feature 986..1045
/gene="Dlx5"
/gene_synonym="RDLX"
/note="propagated from UniProtKB/Swiss-Prot (P50575.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
exon 534..718
/gene="Dlx5"
/gene_synonym="RDLX"
/inference="alignment:Splign:2.1.0"
exon 719..1390
/gene="Dlx5"
/gene_synonym="RDLX"
/inference="alignment:Splign:2.1.0"
ORIGIN
gacagagcctccacgactcccagcctcctcctccccgccgccgccgccaccgccgccgcctcctcttcctcctcctcctccctcgctcccacagccatgtctgcttagaccagagcagctccacagccaattctggcagcagcggccgcctcaataggacagccaccgcccgggagctatgacaggagtgtttgacagaagagtcccaagcatccgatccggcgacttccaagctccgttcccgacgtccgccgccatgcaccacccgtctcaggaatcgccaactttgccggagtcctcggccaccgattctgactactacagtcccgcgggggccgcccctcatggctactgctctcctacctctgcttcttaccgcaaagcgctcaacccataccagtaccagtatcacagcgtgaacggctccgcagccggctacccggccaaggcttatgcggactacggctacgccagcccctaccaccagtacggaggcgcctacaaccgagtcccgagtgccaccagccagccagagaaagaagtggccgagccagaggtgaggatggtgaatggtaaaccaaagaaagttcgtaaacccaggactatttattccagctttcagctggccgctttacagagaaggtttcagaagactcagtacctcgccctgccagaacgcgcggagttggccgcctctctaggactgacgcaaacacaggtgaaaatctggtttcagaacaaaagatccaagatcaagaagatcatgaaaaacggggagatgcccccggagcacagtcccagctccagcgaccctatggcgtgtaactcgccacagtcaccagcggtgtgggagccccagggctcatcccgctctctcagccaccaccctcatgcccaccctacgacctccaaccagtcccccgcgtccagctacctggagaactcggcttcctggtacccaagtgcagccagctcaatcaattcccacctgccaccgcctggctccctgcagcacccgctggcactggcctccgggacgctttattagatgggctactctctcttgctcagttttgggactacagtgttttcctgttttagaaatcagaaagaaaggaattcatacggggatgtttgaacaatggaaacaaagattcatgtgtaaagctttttttttgcatgtaagttattgcatttcaaaggaccccgcccctttttttacgaaaagaacccttttttgcgcaactgtggacactatcaatggtgccttgaaatctatgacctcaacttttcaaaaagacttttttcaatgttattttaaccgtgtaaataagtgtagatagaggaattaaactgtatattctggataaataaaattatttcgaccatg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]