GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-02 10:37:15, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_012943               1390 bp    mRNA    linear   ROD 03-APR-2024
DEFINITION  Rattus norvegicus distal-less homeobox 5 (Dlx5), mRNA.
ACCESSION   NM_012943
VERSION     NM_012943.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Rattus norvegicus (Norway rat)
  ORGANISM  Rattus norvegicus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Rattus.
REFERENCE   1  (bases 1 to 1390)
  AUTHORS   Li,X., Wu,Y., Xie,F., Zhang,F., Zhang,S., Zhou,J., Chen,D. and
            Liu,A.
  TITLE     miR-339-5p negatively regulates loureirin A-induced hair follicle
            stem cell differentiation by targeting DLX5
  JOURNAL   Mol Med Rep 18 (2), 1279-1286 (2018)
   PUBMED   29901112
  REMARK    GeneRIF: these results suggest that miR3395p negatively regulated
            loureirin Ainduced HFSC differentiation by targeting DLX5,
            resulting in Wnt/betacatenin signaling pathway inhibition.
REFERENCE   2  (bases 1 to 1390)
  AUTHORS   Garaffo,G., Conte,D., Provero,P., Tomaiuolo,D., Luo,Z.,
            Pinciroli,P., Peano,C., D'Atri,I., Gitton,Y., Etzion,T.,
            Gothilf,Y., Gays,D., Santoro,M.M. and Merlo,G.R.
  TITLE     The Dlx5 and Foxg1 transcription factors, linked via miRNA-9 and
            -200, are required for the development of the olfactory and GnRH
            system
  JOURNAL   Mol Cell Neurosci 68, 103-119 (2015)
   PUBMED   25937343
REFERENCE   3  (bases 1 to 1390)
  AUTHORS   Takai,H., Mezawa,M., Choe,J., Nakayama,Y. and Ogata,Y.
  TITLE     Osteogenic transcription factors and proto-oncogene regulate bone
            sialoprotein gene transcription
  JOURNAL   J Oral Sci 55 (3), 209-215 (2013)
   PUBMED   24042587
  REMARK    GeneRIF: results demonstrate that overexpression of Runx2, Dlx5 or
            c-Src stimulates BSP transcription, and suggest that Runx2, Dlx5
            and c-Src might be crucial transcriptional regulators of
            mineralization and bone formation
REFERENCE   4  (bases 1 to 1390)
  AUTHORS   Singh,M., Del Carpio-Cano,F.E., Monroy,M.A., Popoff,S.N. and
            Safadi,F.F.
  TITLE     Homeodomain transcription factors regulate BMP-2-induced
            osteoactivin transcription in osteoblasts
  JOURNAL   J Cell Physiol 227 (1), 390-399 (2012)
   PUBMED   21503878
  REMARK    GeneRIF: OA transcription is differentially regulated by Dlx3,
            Dlx5, and Msx2 during osteoblast differentiation.
REFERENCE   5  (bases 1 to 1390)
  AUTHORS   Hie,M., Iitsuka,N., Otsuka,T., Nakanishi,A. and Tsukamoto,I.
  TITLE     Zinc deficiency decreases osteoblasts and osteoclasts associated
            with the reduced expression of Runx2 and RANK
  JOURNAL   Bone 49 (6), 1152-1159 (2011)
   PUBMED   21893222
REFERENCE   6  (bases 1 to 1390)
  AUTHORS   Merlo,G.R., Paleari,L., Mantero,S., Genova,F., Beverdam,A.,
            Palmisano,G.L., Barbieri,O. and Levi,G.
  TITLE     Mouse model of split hand/foot malformation type I
  JOURNAL   Genesis 33 (2), 97-101 (2002)
   PUBMED   12112878
REFERENCE   7  (bases 1 to 1390)
  AUTHORS   Eisenstat,D.D., Liu,J.K., Mione,M., Zhong,W., Yu,G., Anderson,S.A.,
            Ghattas,I., Puelles,L. and Rubenstein,J.L.
  TITLE     DLX-1, DLX-2, and DLX-5 expression define distinct stages of basal
            forebrain differentiation
  JOURNAL   J Comp Neurol 414 (2), 217-237 (1999)
   PUBMED   10516593
REFERENCE   8  (bases 1 to 1390)
  AUTHORS   Liu,J.K., Ghattas,I., Liu,S., Chen,S. and Rubenstein,J.L.
  TITLE     Dlx genes encode DNA-binding proteins that are expressed in an
            overlapping and sequential pattern during basal ganglia
            differentiation
  JOURNAL   Dev Dyn 210 (4), 498-512 (1997)
   PUBMED   9415433
REFERENCE   9  (bases 1 to 1390)
  AUTHORS   Shirasawa,T., Sakamoto,K. and Tkahashi,H.
  TITLE     Molecular cloning and evolutional analysis of a mammalian homologue
            of the Distal-less 3 (Dlx-3) homeobox gene
  JOURNAL   FEBS Lett 351 (3), 380-384 (1994)
   PUBMED   7915995
REFERENCE   10 (bases 1 to 1390)
  AUTHORS   Zhao,G.Q., Zhao,S., Zhou,X., Eberspaecher,H., Solursh,M. and de
            Crombrugghe,B.
  TITLE     rDlx, a novel distal-less-like homeoprotein is expressed in
            developing cartilages and discrete neuronal tissues
  JOURNAL   Dev Biol 164 (1), 37-51 (1994)
   PUBMED   7913069
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from L24443.1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: L24443.1, D31734.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA5760396 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on conservation, expression,
                                      longest protein
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1390
                     /organism="Rattus norvegicus"
                     /mol_type="mRNA"
                     /strain="Sprague-Dawley"
                     /db_xref="taxon:10116"
                     /chromosome="4"
                     /map="4q21"
     gene            1..1390
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="distal-less homeobox 5"
                     /db_xref="GeneID:25431"
                     /db_xref="RGD:2506"
     exon            1..533
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    155..157
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="upstream in-frame stop codon"
     CDS             179..1048
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="DLX-3; homeobox protein DLX-3"
                     /codon_start=1
                     /product="homeobox protein DLX-5"
                     /protein_id="NP_037075.1"
                     /db_xref="GeneID:25431"
                     /db_xref="RGD:2506"
                     /translation="
MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYRKALNPYQYQYHSVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAHPTTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHPLALASGTLY"
     misc_feature    179..325
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="propagated from UniProtKB/Swiss-Prot (P50575.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    272..532
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:463567"
     misc_feature    278..280
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="Phosphoserine, by MAPK14, in vitro.
                     /evidence=ECO:0000250|UniProtKB:P70396; propagated from
                     UniProtKB/Swiss-Prot (P50575.1); phosphorylation site"
     misc_feature    590..760
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     misc_feature    770..937
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="propagated from UniProtKB/Swiss-Prot (P50575.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     misc_feature    827..829
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="Phosphoserine, by MAPK14, in vitro.
                     /evidence=ECO:0000250|UniProtKB:P70396; propagated from
                     UniProtKB/Swiss-Prot (P50575.1); phosphorylation site"
     misc_feature    986..1045
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /note="propagated from UniProtKB/Swiss-Prot (P50575.1);
                     Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
     exon            534..718
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /inference="alignment:Splign:2.1.0"
     exon            719..1390
                     /gene="Dlx5"
                     /gene_synonym="RDLX"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gacagagcctccacgactcccagcctcctcctccccgccgccgccgccaccgccgccgcctcctcttcctcctcctcctccctcgctcccacagccatgtctgcttagaccagagcagctccacagccaattctggcagcagcggccgcctcaataggacagccaccgcccgggagctatgacaggagtgtttgacagaagagtcccaagcatccgatccggcgacttccaagctccgttcccgacgtccgccgccatgcaccacccgtctcaggaatcgccaactttgccggagtcctcggccaccgattctgactactacagtcccgcgggggccgcccctcatggctactgctctcctacctctgcttcttaccgcaaagcgctcaacccataccagtaccagtatcacagcgtgaacggctccgcagccggctacccggccaaggcttatgcggactacggctacgccagcccctaccaccagtacggaggcgcctacaaccgagtcccgagtgccaccagccagccagagaaagaagtggccgagccagaggtgaggatggtgaatggtaaaccaaagaaagttcgtaaacccaggactatttattccagctttcagctggccgctttacagagaaggtttcagaagactcagtacctcgccctgccagaacgcgcggagttggccgcctctctaggactgacgcaaacacaggtgaaaatctggtttcagaacaaaagatccaagatcaagaagatcatgaaaaacggggagatgcccccggagcacagtcccagctccagcgaccctatggcgtgtaactcgccacagtcaccagcggtgtgggagccccagggctcatcccgctctctcagccaccaccctcatgcccaccctacgacctccaaccagtcccccgcgtccagctacctggagaactcggcttcctggtacccaagtgcagccagctcaatcaattcccacctgccaccgcctggctccctgcagcacccgctggcactggcctccgggacgctttattagatgggctactctctcttgctcagttttgggactacagtgttttcctgttttagaaatcagaaagaaaggaattcatacggggatgtttgaacaatggaaacaaagattcatgtgtaaagctttttttttgcatgtaagttattgcatttcaaaggaccccgcccctttttttacgaaaagaacccttttttgcgcaactgtggacactatcaatggtgccttgaaatctatgacctcaacttttcaaaaagacttttttcaatgttattttaaccgtgtaaataagtgtagatagaggaattaaactgtatattctggataaataaaattatttcgaccatg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]