2024-05-06 18:15:38, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_010759 1143 bp mRNA linear ROD 05-NOV-2021 DEFINITION Mus musculus MAGE family member B1 (Mageb1), mRNA. ACCESSION NM_010759 VERSION NM_010759.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1143) AUTHORS Gordeeva O, Gordeev A and Khaydukov S. TITLE Expression dynamics of Mage family genes during self-renewal and differentiation of mouse pluripotent stem and teratocarcinoma cells JOURNAL Oncotarget 10 (35), 3248-3266 (2019) PUBMED 31143371 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1143) AUTHORS Bailey SD, Xie C, Do R, Montpetit A, Diaz R, Mohan V, Keavney B, Yusuf S, Gerstein HC, Engert JC and Anand S. CONSRTM DREAM investigators TITLE Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study JOURNAL Diabetes Care 33 (10), 2250-2253 (2010) PUBMED 20628086 REMARK GeneRIF: Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) REFERENCE 3 (bases 1 to 1143) AUTHORS Talmud PJ, Drenos F, Shah S, Shah T, Palmen J, Verzilli C, Gaunt TR, Pallas J, Lovering R, Li K, Casas JP, Sofat R, Kumari M, Rodriguez S, Johnson T, Newhouse SJ, Dominiczak A, Samani NJ, Caulfield M, Sever P, Stanton A, Shields DC, Padmanabhan S, Melander O, Hastie C, Delles C, Ebrahim S, Marmot MG, Smith GD, Lawlor DA, Munroe PB, Day IN, Kivimaki M, Whittaker J, Humphries SE and Hingorani AD. CONSRTM ASCOT investigators; NORDIL investigators; BRIGHT Consortium TITLE Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip JOURNAL Am J Hum Genet 85 (5), 628-642 (2009) PUBMED 19913121 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 4 (bases 1 to 1143) AUTHORS Chomez P, De Backer O, Bertrand M, De Plaen E, Boon T and Lucas S. TITLE An overview of the MAGE gene family with the identification of all human members of the family JOURNAL Cancer Res 61 (14), 5544-5551 (2001) PUBMED 11454705 REFERENCE 5 (bases 1 to 1143) AUTHORS Clotman F, De Backer O, De Plaen E, Boon T and Picard J. TITLE Cell- and stage-specific expression of mage genes during mouse spermatogenesis JOURNAL Mamm Genome 11 (8), 696-699 (2000) PUBMED 10920243 REFERENCE 6 (bases 1 to 1143) AUTHORS De Plaen E, De Backer O, Arnaud D, Bonjean B, Chomez P, Martelange V, Avner P, Baldacci P, Babinet C, Hwang SY, Knowles B and Boon T. TITLE A new family of mouse genes homologous to the human MAGE genes JOURNAL Genomics 55 (2), 176-184 (1999) PUBMED 9933564 REFERENCE 7 (bases 1 to 1143) AUTHORS Chomez P, Williams R, De Backer O, Boon T and Vennstrom B. TITLE The SMAGE gene family is expressed in post-meiotic spermatids during mouse germ cell differentiation JOURNAL Immunogenetics 43 (1-2), 97-100 (1996) PUBMED 8537132 REFERENCE 8 (bases 1 to 1143) AUTHORS Dabovic B, Zanaria E, Bardoni B, Lisa A, Bordignon C, Russo V, Matessi C, Traversari C and Camerino G. TITLE A family of rapidly evolving genes from the sex reversal critical region in Xp21 JOURNAL Mamm Genome 6 (9), 571-580 (1995) PUBMED 8535061 REFERENCE 9 (bases 1 to 1143) AUTHORS De Backer O, Verheyden AM, Martin B, Godelaine D, De Plaen E, Brasseur R, Avner P and Boon T. TITLE Structure, chromosomal location, and expression pattern of three mouse genes homologous to the human MAGE genes JOURNAL Genomics 28 (1), 74-83 (1995) PUBMED 7590750 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from U19031.1. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1143 /organism="Mus musculus" /mol_type="mRNA" /strain="DBA/2" /db_xref="taxon:10090" /chromosome="X" /map="X 40.59 cM" gene 1..1143 /gene="Mageb1" /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1; Smage1" /note="MAGE family member B1" /db_xref="GeneID:17145" /db_xref="MGI:MGI:105118" CDS 1..1143 /gene="Mageb1" /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1; Smage1" /note="melanoma antigen, family B, 1" /codon_start=1 /product="MAGE family member B1" /protein_id="NP_034889.1" /db_xref="CCDS:CCDS30267.1" /db_xref="GeneID:17145" /db_xref="MGI:MGI:105118" /translation="
MFSWKASKARSPLSPRYSLPGSTEVLTGCHSYPSRFLSASSFTSALSTVNMPRGQKSKTRSRAKRQQSRREVPVVQPTAEEAGSSPVDQSAGSSFPGGSAPQGVKTPGSFGAGVSCTGSGIGGRNAAVLPDTKSSDGTQAGTSIQHTLKDPIMRKASVLIEFLLDKFKMKEAVTRSEMLAVVNKKYKEQFPEILRRTSARLELVFGLELKEIDPSTHSYLLVGKLGLSTEGSLSSNWGLPRTGLLMSVLGVIFMKGNRATEQEVWQFLHGVGVYAGKKHLIFGEPEEFIRDVVRENYLEYRQVPGSDPPSYEFLWGPRAHAETTKMKVLEVLAKVNGTVPSAFPNLYQLALRDQAGGVPRRRVQGKGVHSKAPSQKSSNM"
misc_feature 163..375 /gene="Mageb1" /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1; Smage1" /note="Melanoma associated antigen family N terminal; Region: MAGE_N; pfam12440" /db_xref="CDD:432554" misc_feature 517..978 /gene="Mageb1" /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1; Smage1" /note="MAGE family; Region: MAGE; pfam01454" /db_xref="CDD:426270" exon 1..1143 /gene="Mageb1" /gene_synonym="dam1; Mage-b1; Mage-rs1; MAGE-Xp; Magel1; Smage1" /inference="alignment:Splign:2.1.0" ORIGIN
atgttctcctggaaagcttcaaaagccaggtctccattaagtccaaggtattctctacctggtagtacagaggtacttacaggttgtcattcttatccttccagattcctgtctgccagctcttttacttcagccctgagcacagtcaacatgcctaggggtcaaaagagtaagacccgctcccgtgcaaaacgacagcagtcacgcagggaggttccagtagttcagcccactgcagaggaagcagggtcttctcctgttgaccagagtgctgggtccagcttccctggtggttctgctcctcagggtgtgaaaacccctggatcttttggtgcaggtgtatcctgcacaggctctggtataggtggtagaaatgctgctgtcctgcctgatacaaaaagttcagatggcacccaggcagggacttccattcagcacacactgaaagatcctatcatgaggaaggctagtgtgctgatagaattcctgctagataaatttaagatgaaagaagcagttacaaggagtgaaatgctggcagtagttaacaagaagtataaggagcaattccctgagatcctcaggagaacttctgcacgcctagaattagtctttggtcttgagttgaaggaaattgatcccagcactcattcctatttgctggtaggcaaactgggtctttccactgagggaagtttgagtagtaactgggggttgcctaggacaggtctcctaatgtctgtcctaggtgtgatcttcatgaagggtaaccgtgccactgagcaagaggtctggcaatttctgcatggagtgggggtatatgctgggaagaagcacttgatctttggcgagcctgaggagtttataagagatgtagtgcgggaaaattacctggagtaccgccaggtacctggcagtgatcccccaagctatgagttcctgtggggacccagagcccatgctgaaacaaccaagatgaaagtcctggaagttttagctaaagtcaatggcacagtccctagtgccttccctaatctctaccagttggctcttagagatcaggcaggaggggtgccaagaaggagagttcaaggcaagggtgttcattccaaggccccatcccaaaagtcctctaacatgtag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]