GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2020-04-06 12:19:00, GGRNA.v2 : RefSeq release 99 (Mar, 2020)

LOCUS       NM_006562               1287 bp    mRNA    linear   PRI 09-FEB-2020
DEFINITION  Homo sapiens ladybird homeobox 1 (LBX1), mRNA.
ACCESSION   NM_006562
VERSION     NM_006562.4
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1287)
  AUTHORS   Takeda K, Kou I, Hosogane N, Otomo N, Yagi M, Kaneko S, Kono H,
            Ishikawa M, Takahashi Y, Ikegami T, Nojiri K, Okada E, Funao H,
            Okuyama K, Tsuji T, Fujita N, Nagoshi N, Tsuji O, Ogura Y, Ishii K,
            Nakamura M, Matsumoto M, Ikegawa S and Watanabe K.
  TITLE     Association of Susceptibility Genes for Adolescent Idiopathic
            Scoliosis and Intervertebral Disc Degeneration With Adult Spinal
            Deformity
  JOURNAL   Spine 44 (23), 1623-1629 (2019)
   PUBMED   31365516
  REMARK    GeneRIF: A LBX1 single nucleotide polymorphism, rs11190870, was
            associated with a strong susceptibility for adult spinal deformity.
REFERENCE   2  (bases 1 to 1287)
  AUTHORS   Jiang H, Yang Q, Liu Y, Guan Y, Zhan X, Xiao Z and Wei Q.
  TITLE     Association between ladybird homeobox 1 gene polymorphisms and
            adolescent idiopathic scoliosis: A MOOSE-compliant meta-analysis
  JOURNAL   Medicine (Baltimore) 98 (27), e16314 (2019)
   PUBMED   31277174
  REMARK    GeneRIF: The pooled results showed a statistically significant
            association between LBX1 gene polymorphisms and adolescent
            idiopathic scoliosis (for rs11190870, T vs C, OR = 1.54, 95% CI =
            1.48-1.61, P < .00001; for rs625039, G vs A, OR = 1.50, 95% CI:
            1.38-1.62; P < .00001; for rs678741, G vs A, OR = 0.74, 95% CI:
            0.63-0.86; P < .0001; for rs11598564, G vs A, OR = 1.41, 95% CI:
            1.31-1.51; P < .0001) Meta-Analysis)
REFERENCE   3  (bases 1 to 1287)
  AUTHORS   Hernandez-Miranda LR, Ibrahim DM, Ruffault PL, Larrosa M, Balueva
            K, Muller T, Weerd W, Stolte-Dijkstra I, Hostra RMW, Brunet JF,
            Fortin G, Mundlos S and Birchmeier C.
  TITLE     Mutation in LBX1/Lbx1 precludes transcription factor cooperativity
            and causes congenital hypoventilation in humans and mice
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 115 (51), 13021-13026 (2018)
   PUBMED   30487221
  REMARK    GeneRIF: Homozygous LBX1 Frameshift Mutation Causes Recessive
            Congenital Central Hypoventilation Syndrome.
REFERENCE   4  (bases 1 to 1287)
  AUTHORS   Qiu Y.
  TITLE     [The current review and prospects of the genetic study and clinical
            treatment of adolescent idiopathic scoliosis]
  JOURNAL   Zhonghua Wai Ke Za Zhi 56 (8), 578-582 (2018)
   PUBMED   30107698
  REMARK    GeneRIF: Genome-wide association study on the etiology of
            adolescent idiopathic scoliosis using samples from more than 5 000
            patients and 6 000 normal controls showed two genes: LBX1-AS1 on
            10q24.32 and TNIK on 3q26.2 highly related to AIS initiation and
            progression [review]
            Review article
REFERENCE   5  (bases 1 to 1287)
  AUTHORS   Nada D, Julien C, Samuels ME and Moreau A.
  TITLE     A Replication Study for Association of LBX1 Locus With Adolescent
            Idiopathic Scoliosis in French-Canadian Population
  JOURNAL   Spine 43 (3), 172-178 (2018)
   PUBMED   28604496
  REMARK    GeneRIF: We have replicated the association of the LBX1 locus with
            AIS in French-Canadian population, a novel European descent cohort,
            which is known for its unique genetic architecture.
REFERENCE   6  (bases 1 to 1287)
  AUTHORS   Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L,
            Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE,
            Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles
            J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD,
            Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H,
            Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J,
            Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee
            CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner
            L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S,
            Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E,
            Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C,
            Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK,
            Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird
            G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE,
            McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson
            T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan
            S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou
            T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore
            N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J,
            Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead
            SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK,
            Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T,
            Doucette-Stamm L, Beck S, Smith DR and Rogers J.
  TITLE     The DNA sequence and comparative analysis of human chromosome 10
  JOURNAL   Nature 429 (6990), 375-381 (2004)
   PUBMED   15164054
REFERENCE   7  (bases 1 to 1287)
  AUTHORS   de Mollerat XJ, Gurrieri F, Morgan CT, Sangiorgi E, Everman DB,
            Gaspari P, Amiel J, Bamshad MJ, Lyle R, Blouin JL, Allanson JE, Le
            Marec B, Wilson M, Braverman NE, Radhakrishna U, Delozier-Blanchet
            C, Abbott A, Elghouzzi V, Antonarakis S, Stevenson RE, Munnich A,
            Neri G and Schwartz CE.
  TITLE     A genomic rearrangement resulting in a tandem duplication is
            associated with split hand-split foot malformation 3 (SHFM3) at
            10q24
  JOURNAL   Hum. Mol. Genet. 12 (16), 1959-1971 (2003)
   PUBMED   12913067
REFERENCE   8  (bases 1 to 1287)
  AUTHORS   Kozmik Z, Holland LZ, Schubert M, Lacalli TC, Kreslova J, Vlcek C
            and Holland ND.
  TITLE     Characterization of Amphioxus AmphiVent, an evolutionarily
            conserved marker for chordate ventral mesoderm
  JOURNAL   Genesis 29 (4), 172-179 (2001)
   PUBMED   11309850
REFERENCE   9  (bases 1 to 1287)
  AUTHORS   Jagla K, Dolle P, Mattei MG, Jagla T, Schuhbaur B, Dretzen G,
            Bellard F and Bellard M.
  TITLE     Mouse Lbx1 and human LBX1 define a novel mammalian homeobox gene
            family related to the Drosophila lady bird genes
  JOURNAL   Mech. Dev. 53 (3), 345-356 (1995)
   PUBMED   8645601
REFERENCE   10 (bases 1 to 1287)
  AUTHORS   Moretti P, Simmons P, Thomas P, Haylock D, Rathjen P, Vadas M and
            D'Andrea R.
  TITLE     Identification of homeobox genes expressed in human haemopoietic
            progenitor cells
  JOURNAL   Gene 144 (2), 213-219 (1994)
   PUBMED   7518789
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL135794.19 and BC069156.1.
            This sequence is a reference standard in the RefSeqGene project.
            On May 5, 2005 this sequence version replaced NM_006562.3.
            
            Summary: This gene and the orthologous mouse gene were found by
            their homology to the Drosophila lady bird early and late homeobox
            genes. In the mouse, this gene is a key regulator of muscle
            precursor cell migration and is required for the acquisition of
            dorsal identities of forelimb muscles. [provided by RefSeq, Jul
            2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC069156.1, BC136321.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2148874, SAMEA2154361
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-409               AL135794.19        83191-83599         c
            410-1287            BC069156.1         411-1288
FEATURES             Location/Qualifiers
     source          1..1287
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q24.32"
     gene            1..1287
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="ladybird homeobox 1"
                     /db_xref="GeneID:10660"
                     /db_xref="HGNC:HGNC:16960"
                     /db_xref="MIM:604255"
     exon            1..470
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /inference="alignment:Splign:2.1.0"
     variation       4..23
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="cccgcgccc"
                     /replace="cccgcgcccggcccgcgccc"
                     /db_xref="dbSNP:1444786500"
     variation       4
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1041386686"
     variation       6
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1440138549"
     variation       8
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1564696371"
     variation       9
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1175237419"
     variation       11
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:943968834"
     variation       12
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1303445079"
     variation       14
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:908240860"
     variation       33
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1333674434"
     variation       35
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:982478843"
     variation       36
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1219075571"
     variation       44
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:952316567"
     variation       46
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1176353107"
     variation       47
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:919691544"
     variation       49
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1397808389"
     variation       52
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1564696354"
     variation       57
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:991206892"
     variation       60..80
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="gcccg"
                     /replace="gcccgcgccgtccggcgcccg"
                     /db_xref="dbSNP:1480835440"
     variation       61
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1460518476"
     variation       63
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1456951186"
     variation       65
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1196344813"
     variation       66
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1397134036"
     variation       72
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:541785921"
     variation       80
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1239666846"
     variation       83
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1174424454"
     variation       89
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1454574101"
     variation       90
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265020750"
     variation       97
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749032901"
     variation       98
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434769073"
     variation       101
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177106597"
     variation       102
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1335273046"
     variation       105
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:756384050"
     variation       106
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1422982150"
     variation       107
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326706739"
     variation       108
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746254775"
     variation       110
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1173087784"
     variation       111
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781495254"
     variation       113
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751671979"
     variation       115
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1033834154"
     variation       117..124
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="ccccggcc"
                     /replace="ccccggccccggccggtccccggcc"
                     /db_xref="dbSNP:748378062"
     variation       117
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1278588701"
     variation       121
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764313562"
     variation       123
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758585728"
     variation       125
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1370215897"
     variation       127
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752530442"
     variation       132
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765236602"
     variation       143
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759188951"
     CDS             146..991
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="lady bird-like homeobox; transcription factor
                     similar to D. melanogaster homeodomain protein lady bird
                     late; ladybird homeobox protein homolog 1; ladybird
                     homeobox homolog 1"
                     /codon_start=1
                     /product="transcription factor LBX1"
                     /protein_id="NP_006553.2"
                     /db_xref="CCDS:CCDS31270.1"
                     /db_xref="GeneID:10660"
                     /db_xref="HGNC:HGNC:16960"
                     /db_xref="MIM:604255"
                     /translation="
MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD"
     misc_feature    order(521..535,539..541,590..592,608..610,647..649,
                     653..658,665..670,674..682,686..691)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    527..688
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:278475"
     misc_feature    order(527..529,536..538,656..658,665..670,677..679)
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     variation       153
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1459185807"
     variation       154
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:776557348"
     variation       156
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:766003298"
     variation       160
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:574381608"
     variation       161
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760369442"
     variation       163
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:772676696"
     variation       164
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771528976"
     variation       165
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139870892"
     variation       167
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:775799886"
     variation       171
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770335924"
     variation       174
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:746210714"
     variation       175
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:781726145"
     variation       178
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1474988314"
     variation       180
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1255870380"
     variation       181
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757525480"
     variation       182
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1443500331"
     variation       187
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201625035"
     variation       188
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1489353886"
     variation       189
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:758355487"
     variation       191
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:752829144"
     variation       194
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1259399105"
     variation       195
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1218919499"
     variation       199
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765083052"
     variation       201
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:755002388"
     variation       202
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:753609321"
     variation       210
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1401329960"
     variation       211
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1564696277"
     variation       212
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328175825"
     variation       215
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1389572877"
     variation       216
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766202085"
     variation       217
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1332062928"
     variation       218
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201740254"
     variation       220
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144681046"
     variation       229
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1021587363"
     variation       230
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1448856637"
     variation       232
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1473365447"
     variation       235
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78030099"
     variation       239
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1180344255"
     variation       253
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:767169264"
     variation       259
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:761159519"
     variation       260
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:773975495"
     variation       262
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1467758664"
     variation       266
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270944177"
     variation       269
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1211258858"
     variation       273
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356834055"
     variation       274
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:770184475"
     variation       276
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760134879"
     variation       278
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1337417136"
     variation       279
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:149366935"
     variation       280
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:777314146"
     variation       283
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771377105"
     variation       284
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:976174629"
     variation       286
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199856457"
     variation       289
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1279469207"
     variation       291
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1362082730"
     variation       292
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:964672390"
     variation       294
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1384766655"
     variation       296
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778075900"
     variation       298
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1471460383"
     variation       300
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:772406585"
     variation       302
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1193540961"
     variation       305
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:78808889"
     variation       306
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1453337590"
     variation       308..311
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1287347929"
     variation       308
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748164654"
     variation       310
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1227337140"
     variation       311
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779099123"
     variation       312
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775436724"
     variation       313
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1451769597"
     variation       314
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1283331863"
     variation       316
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372911687"
     variation       318
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1180197500"
     variation       321
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1223020457"
     variation       322
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765415448"
     variation       326
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1286726836"
     variation       327
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1233470514"
     variation       328
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1368924389"
     variation       329
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1276666567"
     variation       330
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437490336"
     variation       334
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1326038242"
     variation       337
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201116367"
     variation       339
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1218741375"
     variation       340
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:755844405"
     variation       341
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:750221025"
     variation       342
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1472535462"
     variation       343
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1173602358"
     variation       344
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433372909"
     variation       345
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1392744033"
     variation       346
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:767070677"
     variation       353
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761580258"
     variation       354
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1241098274"
     variation       355
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1190557621"
     variation       356
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1489188241"
     variation       359
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751007989"
     variation       360
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210139359"
     variation       361
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1345584064"
     variation       365
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374088465"
     variation       366
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:762578273"
     variation       367
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1006789896"
     variation       368
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370705329"
     variation       369
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:771573097"
     variation       371
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367613299"
     variation       372
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:887032168"
     variation       373
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:941909"
     variation       374
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772162855"
     variation       376
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:930978329"
     variation       378
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1177618912"
     variation       380
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748443716"
     variation       382
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779033539"
     variation       384
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1418164651"
     variation       385
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:768732597"
     variation       388
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1248338996"
     variation       389
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:919577485"
     variation       393
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1424100964"
     variation       394
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1186913128"
     variation       397
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1484655324"
     variation       400
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749381215"
     variation       401
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1210712822"
     variation       403
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437355105"
     variation       404
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1270940427"
     variation       406
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1220716119"
     variation       407
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1318818417"
     variation       409
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779898134"
     variation       410
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1231780527"
     variation       411
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1284922642"
     variation       413
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:991260880"
     variation       415
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1303998823"
     variation       418
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:181600364"
     variation       419
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:554998242"
     variation       424
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1353467362"
     variation       430
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1328629688"
     variation       435
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1466891699"
     variation       437
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1423816982"
     variation       438
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1239302375"
     variation       439
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781315859"
     variation       442
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:937070635"
     variation       443
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750202790"
     variation       446
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1474138369"
     variation       452
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1415651462"
     variation       457
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:894800042"
     variation       459
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1378802505"
     variation       463
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1055225594"
     variation       465
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1399756423"
     variation       467
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:781085498"
     exon            471..1285
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /inference="alignment:Splign:2.1.0"
     variation       475
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1452863368"
     variation       476
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1290882169"
     variation       478
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:757024359"
     variation       479
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:889329802"
     variation       482
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1423471448"
     variation       488
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746787274"
     variation       492
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1243699054"
     variation       500
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777481294"
     variation       501
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200100962"
     variation       506
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752235246"
     variation       508
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930773396"
     variation       511
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764879774"
     variation       520
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1359322340"
     variation       523
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754567553"
     variation       537
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1564695898"
     variation       538
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750892945"
     variation       549
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:569188647"
     variation       553
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:762168496"
     variation       563
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377566797"
     variation       568
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1045803823"
     variation       571
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:764284419"
     variation       583
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138821635"
     variation       589
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1362151611"
     variation       591
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1230358298"
     variation       594
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1270544543"
     variation       595
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313424992"
     variation       596
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:763209093"
     variation       599
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1381271558"
     variation       604
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1036343277"
     variation       605
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1312582850"
     variation       607
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429834495"
     variation       610
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781557515"
     variation       614
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1445336559"
     variation       619
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775512624"
     variation       621
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200544289"
     variation       622
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1400572543"
     variation       627
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1217966141"
     variation       631
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:745951412"
     variation       643
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:532179935"
     variation       645
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564963650"
     variation       646
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:746808888"
     variation       652
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1378276897"
     variation       657
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374673460"
     variation       658
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1483023997"
     variation       659..680
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="tggttccagaatcggcgcgcta"
                     /db_xref="dbSNP:1476953432"
     variation       672
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1182004667"
     variation       685
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:758093491"
     variation       691
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1194748506"
     variation       694
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1485636644"
     variation       700
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1424694166"
     variation       704
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:747764111"
     variation       710
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12776987"
     variation       712
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:778729760"
     variation       715
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754479753"
     variation       718
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12778447"
     variation       719
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1364425345"
     variation       725
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753290654"
     variation       730
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1226269144"
     variation       733
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150343401"
     variation       739
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1158574226"
     variation       745
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:757759050"
     variation       748
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1406497750"
     variation       754
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751928265"
     variation       755
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12776825"
     variation       758
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:764478442"
     variation       763
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763334617"
     variation       764
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1397684239"
     variation       765
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141719108"
     variation       766
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1297639311"
     variation       767
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:765454424"
     variation       769
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759659325"
     variation       770
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201747133"
     variation       771
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12777140"
     variation       772
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771945234"
     variation       775
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1054110961"
     variation       778
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1424854774"
     variation       781
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1423288304"
     variation       787
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1256285597"
     variation       789
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12777128"
     variation       790
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:917807575"
     variation       791
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:12776802"
     variation       794
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199635468"
     variation       795
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778641851"
     variation       796
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1348365868"
     variation       801
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1198883424"
     variation       802
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:959457907"
     variation       803..813
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="ggcggtggcgg"
                     /replace="ggcggtggcggtggcgg"
                     /db_xref="dbSNP:779320459"
     variation       803
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768258734"
     variation       805
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1282191719"
     variation       806
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246933443"
     variation       808
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1340918634"
     variation       812
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370090440"
     variation       816
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757749183"
     variation       820
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1379200375"
     variation       821
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1332345860"
     variation       824
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751966314"
     variation       825
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1389051382"
     variation       826
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1165324032"
     variation       827
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:778272282"
     variation       831
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758699530"
     variation       834
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:561287757"
     variation       840
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1437355706"
     variation       843
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1564695792"
     variation       846
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:925440581"
     variation       847
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:543223691"
     variation       848
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1178332623"
     variation       849
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:759728893"
     variation       850
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1287471636"
     variation       853
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753925634"
     variation       854
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1356766880"
     variation       856
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1408032429"
     variation       857
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:766331423"
     variation       858
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199819784"
     variation       859
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200155323"
     variation       860
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:772137654"
     variation       861
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:912598304"
     variation       862
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:987213956"
     variation       863
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:761695761"
     variation       866
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:774344628"
     variation       867
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768329748"
     variation       869
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:368271119"
     variation       870
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1384695933"
     variation       871
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779784691"
     variation       874
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1019153303"
     variation       875
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769133813"
     variation       876
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:745389734"
     variation       879
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1477497171"
     variation       880
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:778251802"
     variation       881
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1200540649"
     variation       883
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1452005189"
     variation       884
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758965574"
     variation       889
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:748493519"
     variation       890
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1355715794"
     variation       892
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1286832952"
     variation       894
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:779290896"
     variation       903
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1342948763"
     variation       904
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:755401297"
     variation       905
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1276899630"
     variation       907
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1198288421"
     variation       908
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:962561467"
     variation       909
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234202199"
     variation       910
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753959715"
     variation       912
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:889271580"
     variation       914
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377118339"
     variation       915
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756080073"
     variation       916
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1361664866"
     variation       917
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1312787281"
     variation       919
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1205828320"
     variation       921
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144870790"
     variation       922
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767548212"
     variation       927
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1049253627"
     variation       929
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1174015740"
     variation       930
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:774252655"
     variation       932
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1430824652"
     variation       936
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:971731139"
     variation       939
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:763753178"
     variation       940
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:762826884"
     variation       944
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:774944786"
     variation       949
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556049854"
     variation       950
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1440811410"
     variation       951
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371863719"
     variation       952
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1201271279"
     variation       954
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:769560237"
     variation       958
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1276707295"
     variation       959..963
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="ga"
                     /replace="gagga"
                     /db_xref="dbSNP:755087702"
     variation       965
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141161147"
     variation       967
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1284163300"
     variation       968
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1446427670"
     variation       969
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356951609"
     variation       973
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:776172521"
     variation       976
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1564695704"
     variation       979
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1414686033"
     variation       980
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772539789"
     variation       982
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1168078923"
     variation       985
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:577653354"
     variation       988
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1424035521"
     variation       993
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150918757"
     variation       995
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:755242503"
     variation       997
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:749666785"
     variation       998
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:547938282"
     variation       1000
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780133460"
     variation       1001
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:756462879"
     variation       1009
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1200723498"
     variation       1010
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750507875"
     variation       1011
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:757439246"
     variation       1018
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227135251"
     variation       1020
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1010337485"
     variation       1022
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1225392738"
     variation       1024
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:751491376"
     variation       1026
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:764102635"
     variation       1028
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:891435466"
     variation       1030
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:762655192"
     variation       1032
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775416742"
     variation       1032
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:753920962"
     variation       1033
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1210171671"
     variation       1037
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:764779848"
     variation       1038
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1056769726"
     variation       1039
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1564695648"
     variation       1044
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1422615942"
     variation       1045
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:937965677"
     variation       1051
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:926550170"
     variation       1054
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1040266597"
     variation       1057
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:111303170"
     variation       1060
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1228463742"
     variation       1061
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314735755"
     variation       1063
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1357800233"
     variation       1064
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:967861736"
     variation       1067
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1160260807"
     variation       1077
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:765343334"
     variation       1079
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1564695635"
     variation       1085
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1293231423"
     variation       1089
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:534762409"
     variation       1090
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356425825"
     variation       1092
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1457212611"
     variation       1094..1096
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1193485590"
     variation       1095
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1051328894"
     variation       1096
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:987888953"
     variation       1097
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1242279815"
     variation       1115
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:965676357"
     variation       1117
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1018641878"
     variation       1118
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1008208013"
     variation       1120
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1475541207"
     variation       1121..1122
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="gg"
                     /db_xref="dbSNP:1255738596"
     variation       1121
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1452968194"
     variation       1123
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1564695615"
     variation       1125
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1387260977"
     variation       1126
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953632278"
     variation       1135
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482168421"
     variation       1136
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1243685571"
     variation       1139
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216206422"
     variation       1141
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:974193892"
     variation       1148
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1328482688"
     variation       1154
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1266155795"
     variation       1162
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1234609887"
     variation       1165
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1267737282"
     variation       1166
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1028337269"
     variation       1172
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:994983023"
     variation       1173
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:927330265"
     variation       1177..1203
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="cggcc"
                     /replace="cggccgggccggccgccaccagcggcc"
                     /db_xref="dbSNP:1404108999"
     variation       1178
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:567758209"
     variation       1180
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1294731309"
     variation       1181
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1363595090"
     variation       1182
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1015015505"
     variation       1183..1198
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="ggccggccgccaccag"
                     /db_xref="dbSNP:923797659"
     variation       1187
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1418380270"
     variation       1190
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1014375189"
     variation       1191
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1365574970"
     variation       1199
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:895800359"
     variation       1204
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1471081569"
     variation       1208
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1337757897"
     variation       1211
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1055773416"
     variation       1215
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1032635010"
     variation       1216
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:937351289"
     variation       1219
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1309839906"
     variation       1222
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:570636149"
     variation       1224
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:900268373"
     variation       1225
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181240194"
     variation       1226
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1367920666"
     variation       1227
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1162748224"
     variation       1228
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:946548908"
     variation       1231
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:891265786"
     variation       1231
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1480209611"
     variation       1232
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1252656332"
     variation       1240
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1262694443"
     variation       1243
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:547807620"
     variation       1250
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472886386"
     variation       1263
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1464228075"
     variation       1264
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1198703031"
     variation       1274
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1051807990"
     variation       1283
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:536472124"
     polyA_site      1285
                     /gene="LBX1"
                     /gene_synonym="homeobox; HPX-6; HPX6; LBX1H"
                     /experiment="experimental evidence, no additional details
                     recorded"
ORIGIN      
ggccccgcgcccggcccgcgccctgcccagtgcggcctcctttccacccgccgctgcctgcccgcgccgtccggcgcccgagctgcccgcgggctgggtccccgcggcccgagccgccccggccgggaccccgaacaaggccgagatgacttccaaggaggacggcaaggcggcgccgggggaggagcggcggcgcagcccgctggaccacctgcctccgcctgccaactccaacaagccactgacgccgttcagcatcgaggacatcctcaacaagccgtctgtgcggagaagttactcgctgtgcggggcggcgcacctgctggccgccgcggacaagcacgcgcagggcggcttgcccctggcgggccgcgcgctgctctcgcagacctcgccgctgtgcgcgctggaggagctcgccagcaagacgtttaaggggctggaggtcagcgttctgcaggcagccgaaggccgcgacggtatgaccatctttgggcagcggcagacccctaagaagcggcgaaagtcgcgcacggccttcaccaaccaccagatctatgaattggaaaagcgctttctataccagaagtacctgtcccccgccgatcgcgaccaaatcgcgcagcagctgggcctcaccaacgcgcaagtcatcacctggttccagaatcggcgcgctaagctcaagcgggacctggaggagatgaaggccgacgtagagtccgccaagaaactgggccccagcgggcagatggacatcgtggcgctggccgaactcgagcagaactcggaggccacagccggcggtggcggcggctgcggcagggccaagtcgaggcccggctctccggtcctccccccaggcgccccgaaggccccgggcgctggcgccctgcagctctcgcctgcctctccgctcacggaccagccggccagcagccaggactgctcggaggacgaggaagacgaagagatcgacgtggacgattgagcggcgccccgggtcttccgccgccctgggctcctagcgctcgaaagcccaacgcctcccggaccggaccgccgaggggagctgggacctcctctgccaactcccgcctcctcccctgtccccggccccggactcggctcctggcagccgcctcttccctctcgaagcaataaacccaggctggccggccgggccggccgccaccagcggcctccgccgccccggaagccctcgccgtgcaattctgtatggcttctatataaatatttaaacctatatagcgggttcttcccaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]